(data stored in ACNUC1104 zone)

EMBL: CP001966.PE535

CP001966.PE535       Location/Qualifiers
FT   CDS             576991..577464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0549"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: sen:SACE_0389 MarR family transcriptional
FT                   regulator; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77189"
FT                   /db_xref="GOA:D5USC2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5USC2"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADG77189.1"
FT                   /translation="MTDDERAERIEDLVRVIADLTRLKERHAAMTRHAVAPDGVELAAY
FT                   SALFALVKDGPMRSSVLAEQIHTDPSTASRYVTTLTNQGYAERTPDPSDRRAALVAATQ
FT                   AGRDKVAFIREQRNIRLRPLLQEWSDEEIEQFVKLGSRALDQFEQALRLLRED"
     MTDDERAERI EDLVRVIADL TRLKERHAAM TRHAVAPDGV ELAAYSALFA LVKDGPMRSS        60
     VLAEQIHTDP STASRYVTTL TNQGYAERTP DPSDRRAALV AATQAGRDKV AFIREQRNIR       120
     LRPLLQEWSD EEIEQFVKLG SRALDQFEQA LRLLRED                                157
//

If you have problems or comments...

PBIL Back to PBIL home page