(data stored in ACNUC1104 zone)

EMBL: CP001966.PE536

CP001966.PE536       Location/Qualifiers
FT   CDS             577465..580653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0550"
FT                   /product="tRNA-guanine transglycosylase, various
FT                   specificities"
FT                   /EC_number="2.4.2.29"
FT                   /note="TIGRFAM: tRNA-guanine transglycosylase, various
FT                   specificities; drug resistance transporter, EmrB/QacA
FT                   subfamily; KEGG: rha:RHA1_ro04399 major facilitator
FT                   superfamily multidrug transporter; PFAM: major facilitator
FT                   superfamily MFS_1; Queuine/other tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77190"
FT                   /db_xref="GOA:D5USC3"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:D5USC3"
FT                   /inference="protein motif:TFAM:TIGR00449"
FT                   /protein_id="ADG77190.1"
FT                   /translation="MTATTLENQSPEQAAGVPSGPLTHKQILYILAGLMTGMFLAALDQ
FT                   TIVSTAIRTIADDLSGYQLQVWVTTAYLITSTIVTPLYGKLSDIYGRKPFFMFAITVFV
FT                   LGSLLCSFSTSMYELAAFRAVQGLGAGGLMSLALTIVGDIVPPRERARYQGYFLAVFGT
FT                   SSVLGPVLGGVFSGADSILGITGWRWVFLVNVPIGVIALLVVYRVLQLPHTRREGVRID
FT                   WVGAFMLAVGIVPLLIVAEQGREWGWGSTKSITCYAVGAGGVLAFIIIEKMMGEDAIIP
FT                   LRIFRNRIFAQGVLISVVVGAAMFGGISLLPQYFQVVRGASPTVAGFMMLPMVLGLMMG
FT                   SILAGQMISRTGRYRIYPIIGAVLLTVGMWALHYVTADVRLAAVMAGAALIGFGLGNLM
FT                   QPLTLAMQNILPPQDMGVSTAAATFFRQIGGTLGVAVFLSVLFSEMPKNMQSRLTDAAA
FT                   DPDYTAALQRAAAGHDGQAAQEFANKLAARDSSAVSGIMSDTSALQKLPSTLVHPFKAG
FT                   FADSMDTVFLAVTVLSAIGLLLVLFWKSVPLRTAPAMETIEEEVVGAVLAGGPVAEPEP
FT                   AAAADTAPVSPAPVGAHPPGTTGVGTASRAVARQTRAPGPRTVEPVPPDDDRTAPVRVD
FT                   PALAEIAELRSQNAELAAELAELRTGYRAIAGHTRLRAVGASDPTGFRIEVQGPGAART
FT                   GTLSTPHGEIATPAYLPVAARGAVAGITPEMLAALGVQAVTVDLHELYLQPGTAMIEGA
FT                   GGIGRAMAWAGPVLGDTGITAVAAAKKTRVTDEGIAFRSRLDGGAHRWDPEEAVRVAHR
FT                   IGVDIAFAMADPVAATAPRAQLEAGVNRSQQWAARALVEHSWQTADRGDRQSLWAVVTG
FT                   GADAGLRRAAARGLRRLSEQDVQSGGLGFGGYRIDGVRSAAAEALQLRAATEELDRERP
FT                   RHLATVATPADLFAAIEAGIDLFDGTAAAEAGREGRVFTRDGVLDLTDPQLRADFRPID
FT                   PGADRRGPANPADEFTRAYVNHLFAANEGLAVTLCTLHNEHFFATLAADARRALTDGRY
FT                   PAFTESFLRRFAKV"
     MTATTLENQS PEQAAGVPSG PLTHKQILYI LAGLMTGMFL AALDQTIVST AIRTIADDLS        60
     GYQLQVWVTT AYLITSTIVT PLYGKLSDIY GRKPFFMFAI TVFVLGSLLC SFSTSMYELA       120
     AFRAVQGLGA GGLMSLALTI VGDIVPPRER ARYQGYFLAV FGTSSVLGPV LGGVFSGADS       180
     ILGITGWRWV FLVNVPIGVI ALLVVYRVLQ LPHTRREGVR IDWVGAFMLA VGIVPLLIVA       240
     EQGREWGWGS TKSITCYAVG AGGVLAFIII EKMMGEDAII PLRIFRNRIF AQGVLISVVV       300
     GAAMFGGISL LPQYFQVVRG ASPTVAGFMM LPMVLGLMMG SILAGQMISR TGRYRIYPII       360
     GAVLLTVGMW ALHYVTADVR LAAVMAGAAL IGFGLGNLMQ PLTLAMQNIL PPQDMGVSTA       420
     AATFFRQIGG TLGVAVFLSV LFSEMPKNMQ SRLTDAAADP DYTAALQRAA AGHDGQAAQE       480
     FANKLAARDS SAVSGIMSDT SALQKLPSTL VHPFKAGFAD SMDTVFLAVT VLSAIGLLLV       540
     LFWKSVPLRT APAMETIEEE VVGAVLAGGP VAEPEPAAAA DTAPVSPAPV GAHPPGTTGV       600
     GTASRAVARQ TRAPGPRTVE PVPPDDDRTA PVRVDPALAE IAELRSQNAE LAAELAELRT       660
     GYRAIAGHTR LRAVGASDPT GFRIEVQGPG AARTGTLSTP HGEIATPAYL PVAARGAVAG       720
     ITPEMLAALG VQAVTVDLHE LYLQPGTAMI EGAGGIGRAM AWAGPVLGDT GITAVAAAKK       780
     TRVTDEGIAF RSRLDGGAHR WDPEEAVRVA HRIGVDIAFA MADPVAATAP RAQLEAGVNR       840
     SQQWAARALV EHSWQTADRG DRQSLWAVVT GGADAGLRRA AARGLRRLSE QDVQSGGLGF       900
     GGYRIDGVRS AAAEALQLRA ATEELDRERP RHLATVATPA DLFAAIEAGI DLFDGTAAAE       960
     AGREGRVFTR DGVLDLTDPQ LRADFRPIDP GADRRGPANP ADEFTRAYVN HLFAANEGLA      1020
     VTLCTLHNEH FFATLAADAR RALTDGRYPA FTESFLRRFA KV                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page