(data stored in ACNUC1104 zone)

EMBL: CP001966.PE537

CP001966.PE537       Location/Qualifiers
FT   CDS             580690..581367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0551"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fra:Francci3_3820 alkaline phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77191"
FT                   /db_xref="UniProtKB/TrEMBL:D5USC4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77191.1"
FT                   /translation="MRRFDPVRFSSVLAGAAVGGLVLAACGNGGGGDAAPSSTADGPSP
FT                   AASKALVQADLPEGFTVTTVPADTALMSSLQAVQQMKDVEITPAGCKDKNVAAQQEVAD
FT                   TVKFGTQQNVARAQQVAYGVNFLPAEAKLSVFEAAGTGECAAVRLGAVEQTTTRKDLPT
FT                   GTGAQGFVLEFARSVGDQKAESANAYFSKGGVTAMVFANPGADGTLDRTGFEDMVKRVA
FT                   AKL"
     MRRFDPVRFS SVLAGAAVGG LVLAACGNGG GGDAAPSSTA DGPSPAASKA LVQADLPEGF        60
     TVTTVPADTA LMSSLQAVQQ MKDVEITPAG CKDKNVAAQQ EVADTVKFGT QQNVARAQQV       120
     AYGVNFLPAE AKLSVFEAAG TGECAAVRLG AVEQTTTRKD LPTGTGAQGF VLEFARSVGD       180
     QKAESANAYF SKGGVTAMVF ANPGADGTLD RTGFEDMVKR VAAKL                       225
//

If you have problems or comments...

PBIL Back to PBIL home page