(data stored in ACNUC1104 zone)

EMBL: CP001966.PE538

CP001966.PE538       Location/Qualifiers
FT   CDS             complement(581437..581937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0552"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="KEGG: rer:RER_06170 inorganic pyrophosphatase; PFAM:
FT                   Inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77192"
FT                   /db_xref="GOA:D5USC5"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:D5USC5"
FT                   /inference="protein motif:PRIAM:3.6.1.1"
FT                   /protein_id="ADG77192.1"
FT                   /translation="MEFEVTVEIAKGSRNKYEVDHKSGRLKLDRYLYTSFGYPTDYGYI
FT                   EDTLGEDGDPLDALVLLPESVIPGSLVDCRAIGMFKMEDEKGGDDKVLVVPAGDPRWDA
FT                   IQDLEHIDKFELDAIEHFFVHYKDLEPGKFVKGSTWVGKAEAEKEIAASIARAEAAAEG
FT                   IDS"
     MEFEVTVEIA KGSRNKYEVD HKSGRLKLDR YLYTSFGYPT DYGYIEDTLG EDGDPLDALV        60
     LLPESVIPGS LVDCRAIGMF KMEDEKGGDD KVLVVPAGDP RWDAIQDLEH IDKFELDAIE       120
     HFFVHYKDLE PGKFVKGSTW VGKAEAEKEI AASIARAEAA AEGIDS                      166
//

If you have problems or comments...

PBIL Back to PBIL home page