(data stored in ACNUC1104 zone)

EMBL: CP001966.PE539

CP001966.PE539       Location/Qualifiers
FT   CDS             582051..583421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0553"
FT                   /product="D-alanyl-D-alaninecarboxypeptidase/D-alanyl-D-al
FT                   anine-endopeptidase"
FT                   /note="KEGG: rer:RER_06180 D-alanyl-D-alanine
FT                   carboxypeptidase; TIGRFAM: D-alanyl-D-alanine
FT                   carboxypeptidase/D- alanyl-D-alanine-endopeptidase; PFAM:
FT                   peptidase S13 D-Ala-D-Ala carboxypeptidase C"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77193"
FT                   /db_xref="GOA:D5USC6"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D5USC6"
FT                   /inference="protein motif:TFAM:TIGR00666"
FT                   /protein_id="ADG77193.1"
FT                   /translation="MPRSRIRRTLVRLAVTVIVLALVVVGVLAAALGYAAYRDSRDLDA
FT                   QVPPRPAEQAYTPAIAPVAATSAPTAAGVRAQIAAALQNPDLGDFTGVIADAASGGVLW
FT                   ERDAARPRTPASTTKVLTAAAALLTLPADKRITTTVVAGAQPGEVVFVGAGDPTLRAGS
FT                   DSMFTDAPKISDLAAQLRRGGTKITRVVVDTALFTGPDLARGWERADIAGGDVTPMQAL
FT                   TADAGRIRPGEDYSPRVPDPAVSAGRALATALGLPPTAVSTGTAPSGAAQLASVRSAPL
FT                   DVRLRDAMIHSDNVLAESIGREVAAAGGQPLSFDGSARAVTAALRNAGFDLTGVELSDV
FT                   DGLSTLNRISAKVLDEILTAAAGNGKPQLRPLLDMLPVGGSSGTLADRYVTANRPGAGY
FT                   VRAKTGSLSGVSTLSGFVADREGSIITFTLMSSGTPVDVARPAMDAVTAALRGCGCR"
     MPRSRIRRTL VRLAVTVIVL ALVVVGVLAA ALGYAAYRDS RDLDAQVPPR PAEQAYTPAI        60
     APVAATSAPT AAGVRAQIAA ALQNPDLGDF TGVIADAASG GVLWERDAAR PRTPASTTKV       120
     LTAAAALLTL PADKRITTTV VAGAQPGEVV FVGAGDPTLR AGSDSMFTDA PKISDLAAQL       180
     RRGGTKITRV VVDTALFTGP DLARGWERAD IAGGDVTPMQ ALTADAGRIR PGEDYSPRVP       240
     DPAVSAGRAL ATALGLPPTA VSTGTAPSGA AQLASVRSAP LDVRLRDAMI HSDNVLAESI       300
     GREVAAAGGQ PLSFDGSARA VTAALRNAGF DLTGVELSDV DGLSTLNRIS AKVLDEILTA       360
     AAGNGKPQLR PLLDMLPVGG SSGTLADRYV TANRPGAGYV RAKTGSLSGV STLSGFVADR       420
     EGSIITFTLM SSGTPVDVAR PAMDAVTAAL RGCGCR                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page