(data stored in ACNUC1104 zone)

EMBL: CP001966.PE540

CP001966.PE540       Location/Qualifiers
FT   CDS             583428..584465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0554"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rop:ROP_43180 hypothetical protein; TIGRFAM:
FT                   conserved hypothetical protein; PFAM: Protein of unknown
FT                   function DUF2342"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77194"
FT                   /db_xref="InterPro:IPR018766"
FT                   /db_xref="InterPro:IPR022454"
FT                   /db_xref="InterPro:IPR042271"
FT                   /db_xref="UniProtKB/TrEMBL:D5USC7"
FT                   /inference="protein motif:TFAM:TIGR03624"
FT                   /protein_id="ADG77194.1"
FT                   /translation="MATRRHRSPQVDWSLAAAAARRLAGGGPATTAYTRDRAAAQLIGF
FT                   AAEAERHVRDVTGLATGARIPAARTVDRREWVDAAARSMAALLDGDHSGRPGIGARIAG
FT                   LQAGGMLGFVSGSILGQYDPFGTSDGELLLVVPNVLRVERALGLDPDDFRMWVCLHEVT
FT                   HRVQFAANPWLRDHMRDNVAALTGDGDSGTVADLLHRVNAALRGGKRHDGVIGLLQIAA
FT                   PAEQFAAIENLLILGTLLEGHADHVMDAAGPTVVPTVATIRAAFDRRRASPANPLQRVL
FT                   RALLGVDAKIAQYVRGKKFVDAVVADVGMDRFNTVWSGPDTLPRDEEFDEPARWMARVL
FT                   GAPAP"
     MATRRHRSPQ VDWSLAAAAA RRLAGGGPAT TAYTRDRAAA QLIGFAAEAE RHVRDVTGLA        60
     TGARIPAART VDRREWVDAA ARSMAALLDG DHSGRPGIGA RIAGLQAGGM LGFVSGSILG       120
     QYDPFGTSDG ELLLVVPNVL RVERALGLDP DDFRMWVCLH EVTHRVQFAA NPWLRDHMRD       180
     NVAALTGDGD SGTVADLLHR VNAALRGGKR HDGVIGLLQI AAPAEQFAAI ENLLILGTLL       240
     EGHADHVMDA AGPTVVPTVA TIRAAFDRRR ASPANPLQRV LRALLGVDAK IAQYVRGKKF       300
     VDAVVADVGM DRFNTVWSGP DTLPRDEEFD EPARWMARVL GAPAP                       345
//

If you have problems or comments...

PBIL Back to PBIL home page