(data stored in ACNUC1104 zone)

EMBL: CP001966.PE544

CP001966.PE544       Location/Qualifiers
FT   CDS             complement(587274..587711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0558"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_4969 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77198"
FT                   /db_xref="GOA:D5USD1"
FT                   /db_xref="InterPro:IPR024399"
FT                   /db_xref="UniProtKB/TrEMBL:D5USD1"
FT                   /inference="similar to AA sequence:KEGG:Mvan_4969"
FT                   /protein_id="ADG77198.1"
FT                   /translation="MTDPQYPQAPVAAPSPTWNSRFDFYNTYGHPSASAHGAAAFKQLS
FT                   FGERFRLTANGPAFFFGPIYFAIKGPWRKGLSLFGVAVAISALIGVIELAFDISFPAAG
FT                   FGAAIGVLYSTAANWAYYQHVAYGSTSWNPFEGVPLLRARK"
     MTDPQYPQAP VAAPSPTWNS RFDFYNTYGH PSASAHGAAA FKQLSFGERF RLTANGPAFF        60
     FGPIYFAIKG PWRKGLSLFG VAVAISALIG VIELAFDISF PAAGFGAAIG VLYSTAANWA       120
     YYQHVAYGST SWNPFEGVPL LRARK                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page