(data stored in ACNUC1104 zone)

EMBL: CP001966.PE545

CP001966.PE545       Location/Qualifiers
FT   CDS             587870..590275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0559"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.4.3"
FT                   /note="SMART: AAA ATPase; TIGRFAM: ATP-dependent
FT                   metalloprotease FtsH; KEGG: nfa:nfa3980 putative cell
FT                   division protein; PFAM: peptidase M41; peptidase M41 FtsH
FT                   extracellular; AAA ATPase central domain protein; ATPase
FT                   associated with various cellular activities AAA_5"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77199"
FT                   /db_xref="GOA:D5USD2"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D5USD2"
FT                   /inference="protein motif:TFAM:TIGR01241"
FT                   /protein_id="ADG77199.1"
FT                   /translation="MKRKSLIRTLAIIAGFVLLIWAFTMVNSKDRDYTPVSTGLVLSQL
FT                   QANNVTDVQIDDREQTLRVTIDKPIDGVEGKKIFAKYPAGTSRDILADVQDAKTPDGKP
FT                   LQDYTTNVTAESIWQSVLFMLLPILLLVGLFFFLMNRMQGGGRGGVMGFGKSKAKQLTK
FT                   DMPKTTFADVAGADEAVEELYEIKDFLQNPARYQALGAKIPKGVLLYGPPGTGKTLLAR
FT                   AVAGEAGVPFFTISGSDFVEMFVGVGASRVRDLFEQAKENSPCIIFVDEIDAVGRQRGA
FT                   GMGGGHDEREQTLNQLLVEMDGFGDRQGIILIAATNRPDILDPALLRPGRFDRQIPVSN
FT                   PDMAGRKAILEVHAKGKPLADDVDLSGLAKRTPGMSGADLANVINEAALLTARENGSQI
FT                   TAPILEESVDRVVGGPRRKNRIISEHEKKVTAYHEGGHTLAAWATEGLDPVYKVTVLAR
FT                   GRTGGHALAVPENDKGMYTRNEMIGRLIFAMGGRAAEELVFAEPTTGASSDIDQATKIA
FT                   RGMVTEYGMSARLGAVRYGQDDGDPFVGRGIGSGAQYSEAVASQIDEEVRSLVEAAHTE
FT                   AWAILNEYRDVLDVLAGELLEKETLVRKDLERIFASVEKRPRITQFDDFGTRTPSTKPP
FT                   IKTPKEIAIENGDPWPPVDEEAERKKAEQAALAAAAAPSGQNGQVNGQGPQAQPWPVPG
FT                   GQPGYGQGYGQPGYQWGGQSQGYPGPQYPNQPYPGQSGGYPPAPNPYPQPGQYGQPPAG
FT                   GSRPDYGAPAGWSAPGWPPQGQPGQQPGQAPQGQDPEQKSGPDRSSES"
     MKRKSLIRTL AIIAGFVLLI WAFTMVNSKD RDYTPVSTGL VLSQLQANNV TDVQIDDREQ        60
     TLRVTIDKPI DGVEGKKIFA KYPAGTSRDI LADVQDAKTP DGKPLQDYTT NVTAESIWQS       120
     VLFMLLPILL LVGLFFFLMN RMQGGGRGGV MGFGKSKAKQ LTKDMPKTTF ADVAGADEAV       180
     EELYEIKDFL QNPARYQALG AKIPKGVLLY GPPGTGKTLL ARAVAGEAGV PFFTISGSDF       240
     VEMFVGVGAS RVRDLFEQAK ENSPCIIFVD EIDAVGRQRG AGMGGGHDER EQTLNQLLVE       300
     MDGFGDRQGI ILIAATNRPD ILDPALLRPG RFDRQIPVSN PDMAGRKAIL EVHAKGKPLA       360
     DDVDLSGLAK RTPGMSGADL ANVINEAALL TARENGSQIT APILEESVDR VVGGPRRKNR       420
     IISEHEKKVT AYHEGGHTLA AWATEGLDPV YKVTVLARGR TGGHALAVPE NDKGMYTRNE       480
     MIGRLIFAMG GRAAEELVFA EPTTGASSDI DQATKIARGM VTEYGMSARL GAVRYGQDDG       540
     DPFVGRGIGS GAQYSEAVAS QIDEEVRSLV EAAHTEAWAI LNEYRDVLDV LAGELLEKET       600
     LVRKDLERIF ASVEKRPRIT QFDDFGTRTP STKPPIKTPK EIAIENGDPW PPVDEEAERK       660
     KAEQAALAAA AAPSGQNGQV NGQGPQAQPW PVPGGQPGYG QGYGQPGYQW GGQSQGYPGP       720
     QYPNQPYPGQ SGGYPPAPNP YPQPGQYGQP PAGGSRPDYG APAGWSAPGW PPQGQPGQQP       780
     GQAPQGQDPE QKSGPDRSSE S                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page