(data stored in ACNUC1104 zone)

EMBL: CP001966.PE547

CP001966.PE547       Location/Qualifiers
FT   CDS             590870..591742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0561"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="TIGRFAM: dihydropteroate synthase; KEGG:
FT                   rha:RHA1_ro04409 dihydropteroate synthase; PFAM:
FT                   dihydropteroate synthase DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77201"
FT                   /db_xref="GOA:D5USD4"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:D5USD4"
FT                   /inference="protein motif:TFAM:TIGR01496"
FT                   /protein_id="ADG77201.1"
FT                   /translation="MNAASRAAAPPARPGGATLIMGVVNVTTDSFSDGGRYLDLDAALA
FT                   HARELVAEGAAVVDVGGESTRPGAHRVPAEVERDRVVPVITALAAEGIAVSVDTMRASV
FT                   AAAALDAGAAIVNDVSGGRADPAMAGVVAGSSAPWILMHWRPSPGAPGADTWSGIHHGV
FT                   TDYTDVVTEVRDELLHQADAAIAAGIAPERIVLDPGLGFAKNGDHNWALLRGLNTLQDT
FT                   GFRVLVGASRKRFLGELLGGRAPAGREVATAAISALAAREGVWGVRVHDVRATADAIAV
FT                   ARAWKKGGI"
     MNAASRAAAP PARPGGATLI MGVVNVTTDS FSDGGRYLDL DAALAHAREL VAEGAAVVDV        60
     GGESTRPGAH RVPAEVERDR VVPVITALAA EGIAVSVDTM RASVAAAALD AGAAIVNDVS       120
     GGRADPAMAG VVAGSSAPWI LMHWRPSPGA PGADTWSGIH HGVTDYTDVV TEVRDELLHQ       180
     ADAAIAAGIA PERIVLDPGL GFAKNGDHNW ALLRGLNTLQ DTGFRVLVGA SRKRFLGELL       240
     GGRAPAGREV ATAAISALAA REGVWGVRVH DVRATADAIA VARAWKKGGI                  290
//

If you have problems or comments...

PBIL Back to PBIL home page