(data stored in ACNUC1104 zone)

EMBL: CP001966.PE549

CP001966.PE549       Location/Qualifiers
FT   CDS             592122..592610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0563"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridin
FT                   epyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="TIGRFAM:2-amino-4-hydroxy-6-
FT                   hydroxymethyldihydropter idinepyrophosphokinase; KEGG:
FT                   rop:ROP_43270 2-amino-4-hydroxy-6-
FT                   hydroxymethyldihydropteridine pyrophosphokinase; PFAM:
FT                   78-dihydro-6-hydroxymethylpterin- pyrophosphokinase HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77203"
FT                   /db_xref="GOA:D5USD6"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:D5USD6"
FT                   /inference="protein motif:TFAM:TIGR01498"
FT                   /protein_id="ADG77203.1"
FT                   /translation="MTRAVLSIGANLGDAETAVRGAITALGPALVAASPLYRTPPWGGV
FT                   EQDDFINATVLADDPSRTAAGWLDFARDQEAAADRIRDVRWGPRTLDVDVIAVWDAEVP
FT                   IRSDDPELTLPHPRAHQRAFVLVPWRAVDPAAELPGHGTVDDLLAALPAGEVAEVTPL"
     MTRAVLSIGA NLGDAETAVR GAITALGPAL VAASPLYRTP PWGGVEQDDF INATVLADDP        60
     SRTAAGWLDF ARDQEAAADR IRDVRWGPRT LDVDVIAVWD AEVPIRSDDP ELTLPHPRAH       120
     QRAFVLVPWR AVDPAAELPG HGTVDDLLAA LPAGEVAEVT PL                          162
//

If you have problems or comments...

PBIL Back to PBIL home page