(data stored in ACNUC1104 zone)

EMBL: CP001966.PE550

CP001966.PE550       Location/Qualifiers
FT   CDS             592664..593134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0564"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rop:ROP_43280 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77204"
FT                   /db_xref="GOA:D5USD7"
FT                   /db_xref="InterPro:IPR021517"
FT                   /db_xref="UniProtKB/TrEMBL:D5USD7"
FT                   /inference="similar to AA sequence:KEGG:ROP_43280"
FT                   /protein_id="ADG77204.1"
FT                   /translation="MRSTGWIELVVIVLGVGLGTYILVKDLVPPIPIWAGAMLYGIAAA
FT                   DLWIAQLIRSRLAKGQVGMGPGRLHPIAVARAVALAKASAYLGAVSLGFFGGALAFLLT
FT                   KGSELTATHADRPGAWIGLVGAGLLLASALWLEQCCRTPDDPDEQPADTSPA"
     MRSTGWIELV VIVLGVGLGT YILVKDLVPP IPIWAGAMLY GIAAADLWIA QLIRSRLAKG        60
     QVGMGPGRLH PIAVARAVAL AKASAYLGAV SLGFFGGALA FLLTKGSELT ATHADRPGAW       120
     IGLVGAGLLL ASALWLEQCC RTPDDPDEQP ADTSPA                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page