(data stored in ACNUC1104 zone)

EMBL: CP001966.PE552

CP001966.PE552       Location/Qualifiers
FT   CDS             594493..595434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0566"
FT                   /product="Domain of unknown function DUF2520"
FT                   /note="PFAM: Domain of unknown function DUF2520; Putative
FT                   oxidoreductase/dehydrogenase, Rossmann-like domain; KEGG:
FT                   rop:ROP_43300 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77206"
FT                   /db_xref="GOA:D5USD9"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018931"
FT                   /db_xref="InterPro:IPR019665"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037108"
FT                   /db_xref="UniProtKB/TrEMBL:D5USD9"
FT                   /inference="protein motif:PFAM:PF10728"
FT                   /protein_id="ADG77206.1"
FT                   /translation="MPEFQDSPDLLAGIPNPPAPARLSVGVVSAGRVGTALGAAFERAG
FT                   HIVTATAARTHRSRTRAGLRLPEARIETPAVIAEKAELLILAVPDTDLPALVDDLAVAI
FT                   NPSAIVLHTSGALGVGVLAPLARLGCTTIAFHPAMTFVDDPEDTARLASSCIGITAADE
FT                   VGHAVGQALALEIGAEPVRVPEISRPLYHAALAHGANHLVALVDDAVLALRAALAGGVG
FT                   LDTVGGPEAGLAERVLAPLARAALDNALRTGPAALTGPAARGDAEAVARHLAALDTVDP
FT                   LITDAYRGQSRRAAAQSGTSAMIDPVLEKEDR"
     MPEFQDSPDL LAGIPNPPAP ARLSVGVVSA GRVGTALGAA FERAGHIVTA TAARTHRSRT        60
     RAGLRLPEAR IETPAVIAEK AELLILAVPD TDLPALVDDL AVAINPSAIV LHTSGALGVG       120
     VLAPLARLGC TTIAFHPAMT FVDDPEDTAR LASSCIGITA ADEVGHAVGQ ALALEIGAEP       180
     VRVPEISRPL YHAALAHGAN HLVALVDDAV LALRAALAGG VGLDTVGGPE AGLAERVLAP       240
     LARAALDNAL RTGPAALTGP AARGDAEAVA RHLAALDTVD PLITDAYRGQ SRRAAAQSGT       300
     SAMIDPVLEK EDR                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page