(data stored in ACNUC1104 zone)

EMBL: CP001966.PE554

CP001966.PE554       Location/Qualifiers
FT   CDS             596360..596767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0568"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="TIGRFAM: aspartate 1-decarboxylase; KEGG:
FT                   ami:Amir_0326 aspartate 1-decarboxylase; PFAM: aspartate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77208"
FT                   /db_xref="GOA:D5USE1"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:D5USE1"
FT                   /inference="protein motif:TFAM:TIGR00223"
FT                   /protein_id="ADG77208.1"
FT                   /translation="MLRTMMTSKIHRATVTEANLHYVGSVTVDADLLDAANLLEGEQVA
FT                   IVDVTNGARLETYTIAGERGSGVIGINGAAAHLVSPGDIVILIAYGQLDERELKTYAPS
FT                   VVFVDAENKPVELSTDAARVPDGYGLVTGRI"
     MLRTMMTSKI HRATVTEANL HYVGSVTVDA DLLDAANLLE GEQVAIVDVT NGARLETYTI        60
     AGERGSGVIG INGAAAHLVS PGDIVILIAY GQLDERELKT YAPSVVFVDA ENKPVELSTD       120
     AARVPDGYGL VTGRI                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page