(data stored in ACNUC1104 zone)

EMBL: CP001966.PE557

CP001966.PE557       Location/Qualifiers
FT   CDS             598195..599991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0571"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; KEGG: sma:SAV_4749
FT                   lysyl-tRNA synthetase; PFAM: Lysyl-tRNA synthetase class
FT                   1c"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77211"
FT                   /db_xref="GOA:D5USE4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002904"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR023386"
FT                   /db_xref="InterPro:IPR042078"
FT                   /db_xref="UniProtKB/TrEMBL:D5USE4"
FT                   /inference="protein motif:TFAM:TIGR00467"
FT                   /protein_id="ADG77211.1"
FT                   /translation="MTVAPVNAPLDDWVTRLADEAVAFAEQNDAPVKVASGISPSGPIH
FT                   LGNLREVMVPHLVADELRRRGRTVEHIISWDDFDRFRKVPTIDGVDETWEQHIGKPLTR
FT                   VPAPYGSDAANWAEHFRRELETALVELGVTYRGISQTQMYSSGAYIDQVLHAMAERQRI
FT                   DAILERYRTLDKAKKGGVTVDQPEADAEAADAASGSADEADGSGDSGYYPYKPYCSVCG
FT                   TDFTTVIGYDDESTALKYQCRCGHTETVILREHTDGKLVWKVDWPMRWAFEKITFEPSG
FT                   VDHQSPGSSFAVGKDVAPIFGWRRPLGPMYAFVGIRGMAKMSSSKGGVPTAAIALRYLE
FT                   PPLLRWLYGRKKPNQSFDVALDGELPRTYDEWDALTRKVAGDKAQPGDIAAYARAASVA
FT                   DPVEGQVRALALTPRTMPYRTLASVVDITTGDDEQTLRILGALEPDEPLTGLDVLRPRL
FT                   DKATTWVAEQMPAQERTVVRTAPDTDLLRGLTDDERAALRLLLDGSGTPAPEGLGRLED
FT                   DWTLAGITHQVYGVAKVQRGLGADQIVKGDKELGAAQRAFFVLLYRLLVGGDTGPRLPT
FT                   LLLAIGAKRVRELVASDRIQPN"
     MTVAPVNAPL DDWVTRLADE AVAFAEQNDA PVKVASGISP SGPIHLGNLR EVMVPHLVAD        60
     ELRRRGRTVE HIISWDDFDR FRKVPTIDGV DETWEQHIGK PLTRVPAPYG SDAANWAEHF       120
     RRELETALVE LGVTYRGISQ TQMYSSGAYI DQVLHAMAER QRIDAILERY RTLDKAKKGG       180
     VTVDQPEADA EAADAASGSA DEADGSGDSG YYPYKPYCSV CGTDFTTVIG YDDESTALKY       240
     QCRCGHTETV ILREHTDGKL VWKVDWPMRW AFEKITFEPS GVDHQSPGSS FAVGKDVAPI       300
     FGWRRPLGPM YAFVGIRGMA KMSSSKGGVP TAAIALRYLE PPLLRWLYGR KKPNQSFDVA       360
     LDGELPRTYD EWDALTRKVA GDKAQPGDIA AYARAASVAD PVEGQVRALA LTPRTMPYRT       420
     LASVVDITTG DDEQTLRILG ALEPDEPLTG LDVLRPRLDK ATTWVAEQMP AQERTVVRTA       480
     PDTDLLRGLT DDERAALRLL LDGSGTPAPE GLGRLEDDWT LAGITHQVYG VAKVQRGLGA       540
     DQIVKGDKEL GAAQRAFFVL LYRLLVGGDT GPRLPTLLLA IGAKRVRELV ASDRIQPN         598
//

If you have problems or comments...

PBIL Back to PBIL home page