(data stored in ACNUC1104 zone)

EMBL: CP001966.PE558

CP001966.PE558       Location/Qualifiers
FT   CDS             600131..600475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0572"
FT                   /product="Lsr2 protein"
FT                   /note="KEGG: msm:MSMEG_6092 Lsr2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77212"
FT                   /db_xref="InterPro:IPR024412"
FT                   /db_xref="InterPro:IPR042254"
FT                   /db_xref="InterPro:IPR042261"
FT                   /db_xref="UniProtKB/TrEMBL:D5USE5"
FT                   /inference="similar to AA sequence:KEGG:MSMEG_6092"
FT                   /protein_id="ADG77212.1"
FT                   /translation="MARKVTVTLVDDVDDTQTADETVEFGLDGVTYEIDLSAKNAAQLR
FT                   ESLDTWIASARRSGGRKRGARAASAPRGRTPIDRSQSAAIRDWARGAGLKVNDRGRISQ
FT                   DVIDAYNEAN"
     MARKVTVTLV DDVDDTQTAD ETVEFGLDGV TYEIDLSAKN AAQLRESLDT WIASARRSGG        60
     RKRGARAASA PRGRTPIDRS QSAAIRDWAR GAGLKVNDRG RISQDVIDAY NEAN             114
//

If you have problems or comments...

PBIL Back to PBIL home page