(data stored in ACNUC1104 zone)

EMBL: CP001966.PE562

CP001966.PE562       Location/Qualifiers
FT   CDS             604551..605117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0576"
FT                   /product="flavin reductase domain protein FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: mul:MUL_4138 oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77216"
FT                   /db_xref="GOA:D5USE9"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D5USE9"
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /protein_id="ADG77216.1"
FT                   /translation="MTVAGPDEPEFDARTFRHVMGQFCTGVTIIGTTSADAKPVGFACQ
FT                   SFAALSLDPPLVLFCPMKTSRTWKHIEASKTFSVSVLGQAQESVSAAFGRPVDDKFEGL
FT                   DWSPSPLGNPTIDGSLTWMDCTLESVLDGGDHHIAIGRVHALGDVSEEKPLLFYRGAYL
FT                   STEHPRLHPASSLESFLTWDAGAWL"
     MTVAGPDEPE FDARTFRHVM GQFCTGVTII GTTSADAKPV GFACQSFAAL SLDPPLVLFC        60
     PMKTSRTWKH IEASKTFSVS VLGQAQESVS AAFGRPVDDK FEGLDWSPSP LGNPTIDGSL       120
     TWMDCTLESV LDGGDHHIAI GRVHALGDVS EEKPLLFYRG AYLSTEHPRL HPASSLESFL       180
     TWDAGAWL                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page