(data stored in ACNUC1104 zone)

EMBL: CP001966.PE564

CP001966.PE564       Location/Qualifiers
FT   CDS             605896..606276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0578"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77218"
FT                   /db_xref="UniProtKB/TrEMBL:D5USF1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77218.1"
FT                   /translation="MLIGDADVLSHYRALLVREPSLQWAEIWSLASYSKDLSPAAAAPV
FT                   RLPPGRLRGTAEQVLADLDATHAAYQEYLLACAVPLLIQADPRFGNRESQLVTAVSERV
FT                   DSIPAARAALAAIRRYGYRSKR"
     MLIGDADVLS HYRALLVREP SLQWAEIWSL ASYSKDLSPA AAAPVRLPPG RLRGTAEQVL        60
     ADLDATHAAY QEYLLACAVP LLIQADPRFG NRESQLVTAV SERVDSIPAA RAALAAIRRY       120
     GYRSKR                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page