(data stored in ACNUC1104 zone)

EMBL: CP001966.PE565

CP001966.PE565       Location/Qualifiers
FT   CDS             complement(606748..607974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0580"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   abb:ABBFA_001634 NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77219"
FT                   /db_xref="GOA:D5USF2"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5USF2"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /protein_id="ADG77219.1"
FT                   /translation="MTESLLSESLVLPCGQALSNRIAKAAMSEQLAKRDGTASDELRRL
FT                   YAVWASGGAGLLLSGNIMIDRDALTEPGNVILDDARGLDQIRAWTGATNGTEAKIWAQI
FT                   NHPGKVAVSPFNRRPIAPSARRSTVPGYNIRKPRELSSSEIGRMIAKYARTAELAVAGG
FT                   FDGVQVHAAHGYLLSQFLSPLSNQRNDEWGGDETRRMRALLETVAAVRAAVGTGIPVSV
FT                   KLNSTDFLRGGFDSDQALTVALALGEAGIDLLEISGGGYEQPAMTGVAAGQETGADGRG
FT                   YFFEFAQRIRAASTVPIMLTGGLRNPVAMEEILAGGVVDVIGVGRPLTFLPDYPRQLLN
FT                   GRAPALPKSAPRVGYRPADGYLELAWHNNQLHRIAAGNTPQRRPGIRTLAQSLSRITVA
FT                   AGKQMSIPR"
     MTESLLSESL VLPCGQALSN RIAKAAMSEQ LAKRDGTASD ELRRLYAVWA SGGAGLLLSG        60
     NIMIDRDALT EPGNVILDDA RGLDQIRAWT GATNGTEAKI WAQINHPGKV AVSPFNRRPI       120
     APSARRSTVP GYNIRKPREL SSSEIGRMIA KYARTAELAV AGGFDGVQVH AAHGYLLSQF       180
     LSPLSNQRND EWGGDETRRM RALLETVAAV RAAVGTGIPV SVKLNSTDFL RGGFDSDQAL       240
     TVALALGEAG IDLLEISGGG YEQPAMTGVA AGQETGADGR GYFFEFAQRI RAASTVPIML       300
     TGGLRNPVAM EEILAGGVVD VIGVGRPLTF LPDYPRQLLN GRAPALPKSA PRVGYRPADG       360
     YLELAWHNNQ LHRIAAGNTP QRRPGIRTLA QSLSRITVAA GKQMSIPR                    408
//

If you have problems or comments...

PBIL Back to PBIL home page