(data stored in ACNUC1104 zone)

EMBL: CP001966.PE57

CP001966.PE57        Location/Qualifiers
FT   CDS             57964..58539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0057"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="KEGG: rop:ROP_39590 dTDP-6-deoxy-D-xylo-4-hexulose
FT                   3,5-epimerase; PFAM: dTDP-4-dehydrorhamnose 35-epimerase
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76711"
FT                   /db_xref="GOA:D5UPU3"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPU3"
FT                   /inference="protein motif:PRIAM:5.1.3.13"
FT                   /protein_id="ADG76711.1"
FT                   /translation="MAMRARGLTVPGAFEFTPQQFGDDRGRFLEWFKASEFEEATGAPM
FT                   PELQQANCSVSAAGVLRGVHYTLTPPGQAKYVTCVRGAFLDVVVDLRRDSPTFGTWDTV
FT                   LLDDVDRRAVYLPAGLGHAILSLEDRSTVMYLCSVEYAPDVDRELDAFDPDLAIDWPTE
FT                   GRDGTPLTYVRSAKDEAAPSLREVFGGR"
     MAMRARGLTV PGAFEFTPQQ FGDDRGRFLE WFKASEFEEA TGAPMPELQQ ANCSVSAAGV        60
     LRGVHYTLTP PGQAKYVTCV RGAFLDVVVD LRRDSPTFGT WDTVLLDDVD RRAVYLPAGL       120
     GHAILSLEDR STVMYLCSVE YAPDVDRELD AFDPDLAIDW PTEGRDGTPL TYVRSAKDEA       180
     APSLREVFGG R                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page