(data stored in ACNUC1104 zone)

EMBL: CP001966.PE572

CP001966.PE572       Location/Qualifiers
FT   CDS             613691..614476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0588"
FT                   /product="DNA glycosylase/AP lyase, H2TH DNA-binding
FT                   protein"
FT                   /note="PFAM: DNA glycosylase/AP lyase, H2TH DNA-binding;
FT                   Formamidopyrimidine-DNA glycosylase catalytic domain
FT                   protein; KEGG: rer:RER_20980 DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77226"
FT                   /db_xref="GOA:D5UST9"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:D5UST9"
FT                   /inference="protein motif:PFAM:PF06831"
FT                   /protein_id="ADG77226.1"
FT                   /translation="MPEGDTLHNLAARLRPVLAGRVLTGCDLRVPRYATVDLTGRTVDD
FT                   VSARGKHLLIAAGDLTLHSHLKMEGQWHVYRPGERWRRPGHTARAVLAVDGAQVVGFSL
FT                   GFLEVLRTAAVDDALAHLGPDPLGPQWDPERAAENLAATPARPVGLALLDQRNLAGIGN
FT                   VYRNELCFVRGVHPAMEVAACGDLRGWVDDAARLLRANAGRSVRVTTGVDRNGLRAFVY
FT                   DRARRPCLRCGTAISAGSLGADGEAERTIWWCPRCQDAN"
     MPEGDTLHNL AARLRPVLAG RVLTGCDLRV PRYATVDLTG RTVDDVSARG KHLLIAAGDL        60
     TLHSHLKMEG QWHVYRPGER WRRPGHTARA VLAVDGAQVV GFSLGFLEVL RTAAVDDALA       120
     HLGPDPLGPQ WDPERAAENL AATPARPVGL ALLDQRNLAG IGNVYRNELC FVRGVHPAME       180
     VAACGDLRGW VDDAARLLRA NAGRSVRVTT GVDRNGLRAF VYDRARRPCL RCGTAISAGS       240
     LGADGEAERT IWWCPRCQDA N                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page