(data stored in ACNUC1104 zone)

EMBL: CP001966.PE575

CP001966.PE575       Location/Qualifiers
FT   CDS             complement(616044..616760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0591"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: sma:SAV_6393
FT                   protein dithiol-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77229"
FT                   /db_xref="GOA:D5USU2"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5USU2"
FT                   /inference="protein motif:PFAM:PF01323"
FT                   /protein_id="ADG77229.1"
FT                   /translation="MRVDVWTDINCPFCYIGKARFDKALATFEHASDVQVIHRSFELDP
FT                   SAAEGSSEPVVPMIAKKYGISEAEAAANERGLGAQAQELGLQYQVAGRDAGNSFDMHRL
FT                   LHWALELGRQEELLDALYAANFASPEPAFGDRNRLVAIAESAGFDGAAARAVLDDETAY
FT                   ADAVRADEATASRIGVGGVPFFVFDGKYAVSGAQLPSVFTEALDRAWADRPEPLTVIGG
FT                   DDAACGPDGCELPPRG"
     MRVDVWTDIN CPFCYIGKAR FDKALATFEH ASDVQVIHRS FELDPSAAEG SSEPVVPMIA        60
     KKYGISEAEA AANERGLGAQ AQELGLQYQV AGRDAGNSFD MHRLLHWALE LGRQEELLDA       120
     LYAANFASPE PAFGDRNRLV AIAESAGFDG AAARAVLDDE TAYADAVRAD EATASRIGVG       180
     GVPFFVFDGK YAVSGAQLPS VFTEALDRAW ADRPEPLTVI GGDDAACGPD GCELPPRG         238
//

If you have problems or comments...

PBIL Back to PBIL home page