(data stored in ACNUC1104 zone)

EMBL: CP001966.PE578

CP001966.PE578       Location/Qualifiers
FT   CDS             complement(617914..618891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0594"
FT                   /product="Protein of unknown function DUF2236"
FT                   /note="PFAM: Protein of unknown function DUF2236; KEGG:
FT                   rer:RER_04190 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77232"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:D5USU5"
FT                   /inference="protein motif:PFAM:PF09995"
FT                   /protein_id="ADG77232.1"
FT                   /translation="MKLSDGPLRVTDQGFFGPESPTWKVWASPTALIGFQRSVVLEHFD
FT                   PNLTAAVADSAGIYTDPFGRLDRTLAYFLLVATADSKTAIEASEHLMDVHRKATGIEPI
FT                   TGKRYSANNPASQLWIHVTGWHSVLTCYETYGPGPLTPTEEAQYWRDCVLAAELQTCDP
FT                   AEVPTSRDEVRAYFDRVRPGLALTERARRGMHYLLRPRDRGARLRIGGSLIAPATIATL
FT                   PRWMREMGGFDQPRMADAAYPRVVRLAVRAASARHAAGTVALGTLVAPMTGAILRRHFA
FT                   QRAEPAAGVVTPAQARERYGRTASDNADATHSVASSEAPFLTPK"
     MKLSDGPLRV TDQGFFGPES PTWKVWASPT ALIGFQRSVV LEHFDPNLTA AVADSAGIYT        60
     DPFGRLDRTL AYFLLVATAD SKTAIEASEH LMDVHRKATG IEPITGKRYS ANNPASQLWI       120
     HVTGWHSVLT CYETYGPGPL TPTEEAQYWR DCVLAAELQT CDPAEVPTSR DEVRAYFDRV       180
     RPGLALTERA RRGMHYLLRP RDRGARLRIG GSLIAPATIA TLPRWMREMG GFDQPRMADA       240
     AYPRVVRLAV RAASARHAAG TVALGTLVAP MTGAILRRHF AQRAEPAAGV VTPAQARERY       300
     GRTASDNADA THSVASSEAP FLTPK                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page