(data stored in ACNUC1104 zone)

EMBL: CP001966.PE582

CP001966.PE582       Location/Qualifiers
FT   CDS             complement(621372..622454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0598"
FT                   /product="protein of unknown function DUF147"
FT                   /note="PFAM: protein of unknown function DUF147; DNA
FT                   integrity scanning, DisA, linker region; KEGG:
FT                   rer:RER_06820 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77236"
FT                   /db_xref="GOA:D5USU9"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/TrEMBL:D5USU9"
FT                   /inference="protein motif:PFAM:PF02457"
FT                   /protein_id="ADG77236.1"
FT                   /translation="MDLDVADRAFAGNAALRETVTRVAPGTGLRDGIERILRGRTGALI
FT                   VLGYDDTVERICDGGFHLDVEFAPTRLRELSKMDGAVVLSTDGSRIVRANVQLVPDPAI
FT                   PTQESGTRHRSAERTAIETGFPVISVSASMSIVHAYVAGVRHVVEDAAPILSRANLAIA
FT                   TLERYRHRLDEVLGELSRAEIEDVVAVREVAHVVQRLELVRRLAIEIEQSVLELGTSGR
FT                   QIALQLEDLLGEAVSLRDPVLRDYLPGDADVGEVVARIDGLSDADLLTASTVAAALGFS
FT                   DTVEAQDQPVSPRGYRLLGSIPRLQRHQIEALVAAFGSLQTLLAASAADLQGVPGIGAV
FT                   WARQVREGLSRLSELSVERY"
     MDLDVADRAF AGNAALRETV TRVAPGTGLR DGIERILRGR TGALIVLGYD DTVERICDGG        60
     FHLDVEFAPT RLRELSKMDG AVVLSTDGSR IVRANVQLVP DPAIPTQESG TRHRSAERTA       120
     IETGFPVISV SASMSIVHAY VAGVRHVVED AAPILSRANL AIATLERYRH RLDEVLGELS       180
     RAEIEDVVAV REVAHVVQRL ELVRRLAIEI EQSVLELGTS GRQIALQLED LLGEAVSLRD       240
     PVLRDYLPGD ADVGEVVARI DGLSDADLLT ASTVAAALGF SDTVEAQDQP VSPRGYRLLG       300
     SIPRLQRHQI EALVAAFGSL QTLLAASAAD LQGVPGIGAV WARQVREGLS RLSELSVERY       360
//

If you have problems or comments...

PBIL Back to PBIL home page