(data stored in ACNUC1104 zone)

EMBL: CP001966.PE583

CP001966.PE583       Location/Qualifiers
FT   CDS             complement(622465..623850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0599"
FT                   /product="DNA repair protein RadA"
FT                   /note="KEGG: rop:ROP_43750 DNA repair protein RadA;
FT                   TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77237"
FT                   /db_xref="GOA:D5USV0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:D5USV0"
FT                   /inference="protein motif:TFAM:TIGR00416"
FT                   /protein_id="ADG77237.1"
FT                   /translation="MAKPKVQYTCSECGHTVAKWVGRCPSCGAWSTMEEGAPARVGGGS
FT                   GPTAHVGLTLPSTPAVPITRIDPNSTRALPVGIGELDRVLGGGIVPGSVILLAGEPGVG
FT                   KSTLLLDVVHRWASTGRGKSLYVTGEESAGQVRLRAERTGALSDELYLAAESDLGTVLG
FT                   HVEQISPTLMVVDSVQTLSASGVDGVHGGVTQVRAITATLTSLAKASGIAVILVGHVTK
FT                   DGAVAGPRSLEHLVDVVLSFEGDKHSTLRMVRGIKNRFGASDEVGCFEQRESGIAQVTD
FT                   PSGLFLHHRDQAAAGTAVTVGLDGKRPMLGELQALVTPTPLPQPRRAVSGLDSARVAMI
FT                   LAVLTKHGGIENLAQKDVYAATVGGMKITEPAADLALALAIASGAADTALRPNTVVLGE
FT                   VGLAGEVRRVTGVERRLAEAHRMGFTHAIVPPAQERLRVGDMRIAEAATVAEAVRLSRQ
FT                   RKG"
     MAKPKVQYTC SECGHTVAKW VGRCPSCGAW STMEEGAPAR VGGGSGPTAH VGLTLPSTPA        60
     VPITRIDPNS TRALPVGIGE LDRVLGGGIV PGSVILLAGE PGVGKSTLLL DVVHRWASTG       120
     RGKSLYVTGE ESAGQVRLRA ERTGALSDEL YLAAESDLGT VLGHVEQISP TLMVVDSVQT       180
     LSASGVDGVH GGVTQVRAIT ATLTSLAKAS GIAVILVGHV TKDGAVAGPR SLEHLVDVVL       240
     SFEGDKHSTL RMVRGIKNRF GASDEVGCFE QRESGIAQVT DPSGLFLHHR DQAAAGTAVT       300
     VGLDGKRPML GELQALVTPT PLPQPRRAVS GLDSARVAMI LAVLTKHGGI ENLAQKDVYA       360
     ATVGGMKITE PAADLALALA IASGAADTAL RPNTVVLGEV GLAGEVRRVT GVERRLAEAH       420
     RMGFTHAIVP PAQERLRVGD MRIAEAATVA EAVRLSRQRK G                           461
//

If you have problems or comments...

PBIL Back to PBIL home page