(data stored in ACNUC1104 zone)

EMBL: CP001966.PE584

CP001966.PE584       Location/Qualifiers
FT   CDS             complement(623892..624482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0600"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro04458 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77238"
FT                   /db_xref="UniProtKB/TrEMBL:D5USV1"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro04458"
FT                   /protein_id="ADG77238.1"
FT                   /translation="MSARTVSTRRTLTAAAGALLATGALLSVSACGAGQISQTANQVAA
FT                   INGANHNFVDQKKVLSDVHVLYPVTAGQGKLAFVLSNIDPDNKNGGDRLVAITDQNGRN
FT                   ATISGDTSLPAGGSLYGAAPQGSDDNADLTRLKVTLPVDGSWRPGLTNELTFHLQKSGA
FT                   LKIAVPLDAGALPASAAGVTVTGGAEGEKKGGH"
     MSARTVSTRR TLTAAAGALL ATGALLSVSA CGAGQISQTA NQVAAINGAN HNFVDQKKVL        60
     SDVHVLYPVT AGQGKLAFVL SNIDPDNKNG GDRLVAITDQ NGRNATISGD TSLPAGGSLY       120
     GAAPQGSDDN ADLTRLKVTL PVDGSWRPGL TNELTFHLQK SGALKIAVPL DAGALPASAA       180
     GVTVTGGAEG EKKGGH                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page