(data stored in ACNUC1104 zone)

EMBL: CP001966.PE585

CP001966.PE585       Location/Qualifiers
FT   CDS             624817..625305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0601"
FT                   /product="transcriptional regulator, CarD family"
FT                   /note="PFAM: transcription factor CarD; KEGG: nfa:nfa4350
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77239"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:D5USV2"
FT                   /inference="protein motif:PFAM:PF02559"
FT                   /protein_id="ADG77239.1"
FT                   /translation="MIFKVGDTVVYPHHGAALIEAIEIKTIGGREREYLVLKVAQGDLT
FT                   VKVPAENAEVVGVRDVVGQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKV
FT                   AEVVRDLWRREQDRGLSAGEKRMLTKARQILVGELALAEATDDGKAESLLDEALAAAS"
     MIFKVGDTVV YPHHGAALIE AIEIKTIGGR EREYLVLKVA QGDLTVKVPA ENAEVVGVRD        60
     VVGQEGLDKV FQVLRAPHTE EPTNWSRRYK ANLEKLASGD VNKVAEVVRD LWRREQDRGL       120
     SAGEKRMLTK ARQILVGELA LAEATDDGKA ESLLDEALAA AS                          162
//

If you have problems or comments...

PBIL Back to PBIL home page