(data stored in ACNUC1104 zone)

EMBL: CP001966.PE587

CP001966.PE587       Location/Qualifiers
FT   CDS             625961..626434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0603"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="TIGRFAM: 2C-methyl-D-erythritol 2,4-
FT                   cyclodiphosphate synthase; KEGG: mjl:Mjls_5124
FT                   2-C-methyl-D-erythritol 2,4- cyclodiphosphate synthase;
FT                   PFAM: MECDP-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77241"
FT                   /db_xref="GOA:D5USV4"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:D5USV4"
FT                   /inference="protein motif:TFAM:TIGR00151"
FT                   /protein_id="ADG77241.1"
FT                   /translation="MIIPRVGIGTDVHPVEPGRECWMLGLLFDGDGCSGHSDGDVAVHA
FT                   LCDALLSAGGLGDLGTVFGVGRSDNVGITGAEMLTHVRTLLSEAGFAVGNAAVQLIGNR
FT                   PKVGPRRDEAQQVLSELLGAPVSVSATTTDGLGLTGRGEGIAAVATALIYAAS"
     MIIPRVGIGT DVHPVEPGRE CWMLGLLFDG DGCSGHSDGD VAVHALCDAL LSAGGLGDLG        60
     TVFGVGRSDN VGITGAEMLT HVRTLLSEAG FAVGNAAVQL IGNRPKVGPR RDEAQQVLSE       120
     LLGAPVSVSA TTTDGLGLTG RGEGIAAVAT ALIYAAS                                157
//

If you have problems or comments...

PBIL Back to PBIL home page