(data stored in ACNUC1104 zone)

EMBL: CP001966.PE588

CP001966.PE588       Location/Qualifiers
FT   CDS             complement(626419..627342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0604"
FT                   /product="RarD protein, DMT superfamily transporter"
FT                   /note="KEGG: kse:Ksed_21390 RarD protein; TIGRFAM: RarD
FT                   protein, DMT superfamily transporter; PFAM: protein of
FT                   unknown function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77242"
FT                   /db_xref="GOA:D5USV5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:D5USV5"
FT                   /inference="protein motif:TFAM:TIGR00688"
FT                   /protein_id="ADG77242.1"
FT                   /translation="MTDRDVSEATRGTAMGVAAYLLWGLFPLYFDALKPTGPWEILAHR
FT                   ILWTLVLCGAALVILRDLGWIRPVLRQPRLLAGVTIAALLISTNWIVYIVAVTSGHTSD
FT                   AALGYFLNPLVTVALGVVVLRERLRPLQWVAVGIGVLAFIYLAVVAGTFPVTALALAFS
FT                   FGLYGLVKNRVGVHLNALQGLTLETAILAPIAAAVLVGIGIWGGGLDFARHGAGHAALL
FT                   AFAGVATAVPLLLFAAAARRIPLVTIGLIQFATPIMQLLCAVLFLDEHVSPERWVGFGI
FT                   VWVALILLTLDTVLALRRTRSGQLAA"
     MTDRDVSEAT RGTAMGVAAY LLWGLFPLYF DALKPTGPWE ILAHRILWTL VLCGAALVIL        60
     RDLGWIRPVL RQPRLLAGVT IAALLISTNW IVYIVAVTSG HTSDAALGYF LNPLVTVALG       120
     VVVLRERLRP LQWVAVGIGV LAFIYLAVVA GTFPVTALAL AFSFGLYGLV KNRVGVHLNA       180
     LQGLTLETAI LAPIAAAVLV GIGIWGGGLD FARHGAGHAA LLAFAGVATA VPLLLFAAAA       240
     RRIPLVTIGL IQFATPIMQL LCAVLFLDEH VSPERWVGFG IVWVALILLT LDTVLALRRT       300
     RSGQLAA                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page