(data stored in ACNUC1104 zone)

EMBL: CP001966.PE589

CP001966.PE589       Location/Qualifiers
FT   CDS             627428..628825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0605"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="TIGRFAM: cysteinyl-tRNA synthetase; KEGG:
FT                   rha:RHA1_ro04462 cysteinyl-tRNA synthetase; PFAM:
FT                   Cysteinyl-tRNA synthetase class Ia ; Cysteinyl-tRNA
FT                   synthetase class Ia DALR; tRNA synthetase class I (M)"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77243"
FT                   /db_xref="GOA:D5USV6"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:D5USV6"
FT                   /inference="protein motif:TFAM:TIGR00435"
FT                   /protein_id="ADG77243.1"
FT                   /translation="MTLRLYDSLTREVRDFVPLVEGKAGIYLCGATVQGVPHIGHIRSG
FT                   VAFDVLRRWLLATGLDVAFVRNVTDIDDKILRKAAEAGRPWWEWAATHEREFTRAYDAL
FT                   GVLPPSAEPRATGFITQMVTYMERMIERGHAYASAGDVYFSVRSLPDYGALSRQKVDDV
FT                   QQGETLAAGKRDPLDFTLWKAAKPGEPSWPSPWGDGRPGWHLECSAMATSYLGGQFDIH
FT                   CGGMDLVFPHHENEIAQAHGAGDPFANYWLHNGWVTMSGEKMSKSLGNVVSIPNLLTQV
FT                   RAVELRYYLGSAHYRSMQEYSAGALAEAATAYGRIESFVQRTVERTGEVPVGQWSAGFA
FT                   AALDDDLGVPSALAEVHAAVRAGNAALEAGDLDEARRLAGAVRAMTSILGVDPLDPHWV
FT                   TENAGDGAAMDALGVLVQAELERRAAARAEKNWAEADAARDRLHAAGIDVTDGADGSSW
FT                   TLAKKTQ"
     MTLRLYDSLT REVRDFVPLV EGKAGIYLCG ATVQGVPHIG HIRSGVAFDV LRRWLLATGL        60
     DVAFVRNVTD IDDKILRKAA EAGRPWWEWA ATHEREFTRA YDALGVLPPS AEPRATGFIT       120
     QMVTYMERMI ERGHAYASAG DVYFSVRSLP DYGALSRQKV DDVQQGETLA AGKRDPLDFT       180
     LWKAAKPGEP SWPSPWGDGR PGWHLECSAM ATSYLGGQFD IHCGGMDLVF PHHENEIAQA       240
     HGAGDPFANY WLHNGWVTMS GEKMSKSLGN VVSIPNLLTQ VRAVELRYYL GSAHYRSMQE       300
     YSAGALAEAA TAYGRIESFV QRTVERTGEV PVGQWSAGFA AALDDDLGVP SALAEVHAAV       360
     RAGNAALEAG DLDEARRLAG AVRAMTSILG VDPLDPHWVT ENAGDGAAMD ALGVLVQAEL       420
     ERRAAARAEK NWAEADAARD RLHAAGIDVT DGADGSSWTL AKKTQ                       465
//

If you have problems or comments...

PBIL Back to PBIL home page