(data stored in ACNUC1104 zone)

EMBL: CP001966.PE59

CP001966.PE59        Location/Qualifiers
FT   CDS             complement(59652..60677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0059"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP0961c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76713"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPU5"
FT                   /inference="similar to AA sequence:KEGG:MAP0961c"
FT                   /protein_id="ADG76713.1"
FT                   /translation="MSGRRLLWLSPWMRPLARVYCEALEDRGWEVVLVTSDQHPESDAA
FT                   RPYEWVLNPRPKTPSTWAPFARRLRDARRFAPHVVVTELVRDPRWIALAGSAPRVRLVH
FT                   DDRPHDAAEEVPRWERALFDRWNGSAAATVAFSEYVRAEIGADALAPLTSDLAEMLVPP
FT                   MVPATERRDFVAVGRLNGYKNLDVTLDAWERHATGPGWRGDELVLIGDGDAPLRAAPHV
FT                   RRVPGAYSYADVIGPLAAAKGSVAHYRRATQSGVQVLAMQLGVTPIVSDRGALPEFQPP
FT                   GEAAIGVDDVAGLAAAFDALADPEAAARRGAVARAHYLARYGADESAARLEEMLSRVAR
FT                   I"
     MSGRRLLWLS PWMRPLARVY CEALEDRGWE VVLVTSDQHP ESDAARPYEW VLNPRPKTPS        60
     TWAPFARRLR DARRFAPHVV VTELVRDPRW IALAGSAPRV RLVHDDRPHD AAEEVPRWER       120
     ALFDRWNGSA AATVAFSEYV RAEIGADALA PLTSDLAEML VPPMVPATER RDFVAVGRLN       180
     GYKNLDVTLD AWERHATGPG WRGDELVLIG DGDAPLRAAP HVRRVPGAYS YADVIGPLAA       240
     AKGSVAHYRR ATQSGVQVLA MQLGVTPIVS DRGALPEFQP PGEAAIGVDD VAGLAAAFDA       300
     LADPEAAARR GAVARAHYLA RYGADESAAR LEEMLSRVAR I                           341
//

If you have problems or comments...

PBIL Back to PBIL home page