(data stored in ACNUC1104 zone)

EMBL: CP001966.PE592

CP001966.PE592       Location/Qualifiers
FT   CDS             complement(630461..631222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0608"
FT                   /product="LamB/YcsF family protein"
FT                   /note="PFAM: LamB/YcsF family protein; KEGG: rer:RER_07000
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77246"
FT                   /db_xref="GOA:D5USV9"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D5USV9"
FT                   /inference="protein motif:PFAM:PF03746"
FT                   /protein_id="ADG77246.1"
FT                   /translation="MTQRIDLNADCGESYGAWRLGDDDALLGIVSSANVACGFHAGDPS
FT                   TLRATCARAVEQGVRIGAQVGYADVRGFGRRFIEVPPADLTADVIYQIGALQAIARSVG
FT                   GEVTYVKPHGALYNAIVGHTSQARAVVDGVLACTSGLPVLGLPGSEFLRIAAEQGLHPV
FT                   AEAFADRAYTPEGTLVPRSHPGSVLHDPDEIAARVVRMVFDDTVEAIDGTEVELHADSV
FT                   CLHGDNPEAVRVAARLRTVLEGAGAEIAPFN"
     MTQRIDLNAD CGESYGAWRL GDDDALLGIV SSANVACGFH AGDPSTLRAT CARAVEQGVR        60
     IGAQVGYADV RGFGRRFIEV PPADLTADVI YQIGALQAIA RSVGGEVTYV KPHGALYNAI       120
     VGHTSQARAV VDGVLACTSG LPVLGLPGSE FLRIAAEQGL HPVAEAFADR AYTPEGTLVP       180
     RSHPGSVLHD PDEIAARVVR MVFDDTVEAI DGTEVELHAD SVCLHGDNPE AVRVAARLRT       240
     VLEGAGAEIA PFN                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page