(data stored in ACNUC1104 zone)

EMBL: CP001966.PE594

CP001966.PE594       Location/Qualifiers
FT   CDS             complement(632118..632864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0610"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: nfa:nfa4440 putative ABC transporter ATP-
FT                   binding protein; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77248"
FT                   /db_xref="GOA:D5USW1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5USW1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG77248.1"
FT                   /translation="MTEPVVSLRGAALAYRDRTLWDGLDLDVAPGEFVAVLGPNGAGKT
FT                   SLLRVLLGQAALSAGTVDVRGRLGYIPQQRALDAAVPLRGRDLVGLGYDGASWGIGLRR
FT                   RAERRSAVDAALAQVDAQPFADAPVGSLSGGEQQRLRVAQALASDPAVLLCDEPLLSLD
FT                   PGHQQLAVALIERRRREHDTAVLFVTHEINPVLPHCDRVLYLVDGRFEVGATAEVMTSE
FT                   TLSRLYRAPVDVLHVRDRLVVVGGEG"
     MTEPVVSLRG AALAYRDRTL WDGLDLDVAP GEFVAVLGPN GAGKTSLLRV LLGQAALSAG        60
     TVDVRGRLGY IPQQRALDAA VPLRGRDLVG LGYDGASWGI GLRRRAERRS AVDAALAQVD       120
     AQPFADAPVG SLSGGEQQRL RVAQALASDP AVLLCDEPLL SLDPGHQQLA VALIERRRRE       180
     HDTAVLFVTH EINPVLPHCD RVLYLVDGRF EVGATAEVMT SETLSRLYRA PVDVLHVRDR       240
     LVVVGGEG                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page