(data stored in ACNUC1104 zone)

EMBL: CP001966.PE596

CP001966.PE596       Location/Qualifiers
FT   CDS             complement(633836..634261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0612"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mgi:Mflv_3147 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77250"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D5USW3"
FT                   /inference="similar to AA sequence:KEGG:Mflv_3147"
FT                   /protein_id="ADG77250.1"
FT                   /translation="MQEFRDAVLAKDPEAMERTLADDVRFTSPVAFKPYEGRHITAAIL
FT                   RGVLRVMGGDDFRYVREIASADGRDHALVFTTTLDGKEVNGCDFLHLNDDGKIDEFTVM
FT                   VRPLSAAQALAAAMGAQFDRIATEAAEAARAEAAPQS"
     MQEFRDAVLA KDPEAMERTL ADDVRFTSPV AFKPYEGRHI TAAILRGVLR VMGGDDFRYV        60
     REIASADGRD HALVFTTTLD GKEVNGCDFL HLNDDGKIDE FTVMVRPLSA AQALAAAMGA       120
     QFDRIATEAA EAARAEAAPQ S                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page