(data stored in ACNUC1104 zone)

EMBL: CP001966.PE599

CP001966.PE599       Location/Qualifiers
FT   CDS             635625..636392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0615"
FT                   /product="protocatechuate 3,4-dioxygenase, beta subunit"
FT                   /note="KEGG: ach:Achl_3854 protocatechuate 3,4-
FT                   dioxygenase, beta subunit; TIGRFAM: protocatechuate
FT                   3,4-dioxygenase, beta subunit; PFAM: intradiol
FT                   ring-cleavage dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77253"
FT                   /db_xref="GOA:D5USW6"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012785"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR024756"
FT                   /db_xref="UniProtKB/TrEMBL:D5USW6"
FT                   /inference="protein motif:TFAM:TIGR02422"
FT                   /protein_id="ADG77253.1"
FT                   /translation="MDDDQRAISAEIAELSEAYRVGAAPESTARRDYPPYRSSLLRHPT
FT                   KRLHPADPEGVEMLSPVFGQQDVHPLESDLTIHHGGEPLGERITVSGHVLDGAGRPVAG
FT                   QLVEIWQANASGRYVHKRDQHPAPIDPNFTGVGRCLTGPDGSYRFTTVKPGAYPWRNHH
FT                   NAWRPAHIHFSLFGTDFTQRLITQMYFPGDPLIALDPICQSIVDPAARDRLIADYDHEA
FT                   STPEWSLGYRWDIVLGGAGRTWTENEAFGGADR"
     MDDDQRAISA EIAELSEAYR VGAAPESTAR RDYPPYRSSL LRHPTKRLHP ADPEGVEMLS        60
     PVFGQQDVHP LESDLTIHHG GEPLGERITV SGHVLDGAGR PVAGQLVEIW QANASGRYVH       120
     KRDQHPAPID PNFTGVGRCL TGPDGSYRFT TVKPGAYPWR NHHNAWRPAH IHFSLFGTDF       180
     TQRLITQMYF PGDPLIALDP ICQSIVDPAA RDRLIADYDH EASTPEWSLG YRWDIVLGGA       240
     GRTWTENEAF GGADR                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page