(data stored in ACNUC1104 zone)

EMBL: CP001966.PE6

CP001966.PE6         Location/Qualifiers
FT   CDS             6380..7675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0006"
FT                   /product="glycosyl transferase family 28"
FT                   /note="PFAM: glycosyl transferase family 28; KEGG:
FT                   fre:Franean1_0073 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76660"
FT                   /db_xref="GOA:D5UPA8"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPA8"
FT                   /inference="protein motif:PFAM:PF03033"
FT                   /protein_id="ADG76660.1"
FT                   /translation="MRIAIACMGSRGDISPLLAVGRVFADRGDTVTIGCTVESRDFVRS
FT                   HGFEPRILTTLNLKEFLQSPLGQEKFFGTGTATQLRAVGKLADSHADEFDEHLAQLCAD
FT                   VDCVISTRIIEERAALVTHRNGTPLVMLEYFPGDAHSTVPNPLLGPRLQDITATIPVLL
FT                   PLTYRIFDIGWALSIAKKTLHLAKRVGYPRRIINPRSVLNGRDILRVEAFGTALVPPRT
FT                   RSDARQPRIGFIRIEGRPADRAARDRAVEAWIDSDDRPFVYLGFGSMPIVDFDGVVTEL
FT                   AATLAGEGLRLIAVPGWSARTGDEVVETPDLLVLPDIDHDAVFPRCAAIVHHGGAGTTA
FT                   IAAASGRPSLVCSQAFDQHFWGRRIEAAGAGALLSRRRMSARTIAEAVLSLVRDDAVVA
FT                   GARRLGEVAAEDLRGRDQFIEAFDAFVAETGR"
     MRIAIACMGS RGDISPLLAV GRVFADRGDT VTIGCTVESR DFVRSHGFEP RILTTLNLKE        60
     FLQSPLGQEK FFGTGTATQL RAVGKLADSH ADEFDEHLAQ LCADVDCVIS TRIIEERAAL       120
     VTHRNGTPLV MLEYFPGDAH STVPNPLLGP RLQDITATIP VLLPLTYRIF DIGWALSIAK       180
     KTLHLAKRVG YPRRIINPRS VLNGRDILRV EAFGTALVPP RTRSDARQPR IGFIRIEGRP       240
     ADRAARDRAV EAWIDSDDRP FVYLGFGSMP IVDFDGVVTE LAATLAGEGL RLIAVPGWSA       300
     RTGDEVVETP DLLVLPDIDH DAVFPRCAAI VHHGGAGTTA IAAASGRPSL VCSQAFDQHF       360
     WGRRIEAAGA GALLSRRRMS ARTIAEAVLS LVRDDAVVAG ARRLGEVAAE DLRGRDQFIE       420
     AFDAFVAETG R                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page