(data stored in ACNUC1104 zone)

EMBL: CP001966.PE603

CP001966.PE603       Location/Qualifiers
FT   CDS             639517..640740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0619"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.174"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; KEGG:
FT                   aau:AAur_4039 beta-ketoadipyl-CoA thiolase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77257"
FT                   /db_xref="GOA:D5USX0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D5USX0"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADG77257.1"
FT                   /translation="MPDAFVYDALRTPFGRYGGALSGIRPDDLAAHVVRRLVDRAPGLA
FT                   ASDGAAIDEVILGNANGAGEDNRNVARMAALLAGLPVTVPGTTVNRLCGSSLDAVITGS
FT                   RQIEVADAEIVLAGGVESMSRAPWVLPKPDRAFPSGDQALASTTLGWRLVNPRMPAEWT
FT                   VSLGEATEQLRQAHGITRQRQDDFAARSHRAAHRAWEEGVYADLVDPVPGTDLDRDESI
FT                   RPGTTVEALSALRPSFRPAAPEPEGGTVTAGNASPLSDGAAAVLLGSAGAEETIGAAPT
FT                   ARIAGRGASAGAPQSFGAAPIEAADRALRRAGIEWSDVGAVELNEAFAAQALVCLDAWG
FT                   IEPGIVNRFGGAIALGHPLGASGARLIGTLAHTLRVTRQRWGVAALCIGVGQGLALVLE
FT                   NVDVTGDL"
     MPDAFVYDAL RTPFGRYGGA LSGIRPDDLA AHVVRRLVDR APGLAASDGA AIDEVILGNA        60
     NGAGEDNRNV ARMAALLAGL PVTVPGTTVN RLCGSSLDAV ITGSRQIEVA DAEIVLAGGV       120
     ESMSRAPWVL PKPDRAFPSG DQALASTTLG WRLVNPRMPA EWTVSLGEAT EQLRQAHGIT       180
     RQRQDDFAAR SHRAAHRAWE EGVYADLVDP VPGTDLDRDE SIRPGTTVEA LSALRPSFRP       240
     AAPEPEGGTV TAGNASPLSD GAAAVLLGSA GAEETIGAAP TARIAGRGAS AGAPQSFGAA       300
     PIEAADRALR RAGIEWSDVG AVELNEAFAA QALVCLDAWG IEPGIVNRFG GAIALGHPLG       360
     ASGARLIGTL AHTLRVTRQR WGVAALCIGV GQGLALVLEN VDVTGDL                     407
//

If you have problems or comments...

PBIL Back to PBIL home page