(data stored in ACNUC1104 zone)

EMBL: CP001966.PE607

CP001966.PE607       Location/Qualifiers
FT   CDS             643089..644366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0623"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; General
FT                   substrate transporter; KEGG: sco:SCO7435 transmembrane
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77261"
FT                   /db_xref="GOA:D5USX4"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5USX4"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG77261.1"
FT                   /translation="MASTPLTPAAADAALRSVGSPRAWGALLCWMVVVFEGYDLVSLGA
FT                   AIPALLDTGHLGMTASDLRAVATVSLVGVGIGAAVTGAISDRYGRRGPLVACVLLFSVF
FT                   TLLVPVMPTVWALAAVRFIAGLGMGGCMPVALTAMQEAAPERKSNASAVTMTGYHVGAV
FT                   LASLIALLAGNSWQWLFYGGGILGLLLVPVIALRMPETAVVAGTAKPIAAQRADRASVL
FT                   QAPYLRTTLMLFVAAFLGLLVVYGLNTWLPQLMRGAGYPVSTALVMLLVLNVGAVAGLM
FT                   IGGRVADRLGAQRVTVLWFAAASVMLALLSIKVANQVVLDVVIFVTGFFVFTAQVLLYG
FT                   LIGYLYPRTKVGTAMGLVSAVGRLGAIAGPWVTGSLVVAGIGYPWGFYFFAVAAGLAAL
FT                   AVVAVPRPAREEQAADSAAEQAARVA"
     MASTPLTPAA ADAALRSVGS PRAWGALLCW MVVVFEGYDL VSLGAAIPAL LDTGHLGMTA        60
     SDLRAVATVS LVGVGIGAAV TGAISDRYGR RGPLVACVLL FSVFTLLVPV MPTVWALAAV       120
     RFIAGLGMGG CMPVALTAMQ EAAPERKSNA SAVTMTGYHV GAVLASLIAL LAGNSWQWLF       180
     YGGGILGLLL VPVIALRMPE TAVVAGTAKP IAAQRADRAS VLQAPYLRTT LMLFVAAFLG       240
     LLVVYGLNTW LPQLMRGAGY PVSTALVMLL VLNVGAVAGL MIGGRVADRL GAQRVTVLWF       300
     AAASVMLALL SIKVANQVVL DVVIFVTGFF VFTAQVLLYG LIGYLYPRTK VGTAMGLVSA       360
     VGRLGAIAGP WVTGSLVVAG IGYPWGFYFF AVAAGLAALA VVAVPRPARE EQAADSAAEQ       420
     AARVA                                                                   425
//

If you have problems or comments...

PBIL Back to PBIL home page