(data stored in ACNUC1104 zone)

EMBL: CP001966.PE608

CP001966.PE608       Location/Qualifiers
FT   CDS             complement(644373..645344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0624"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein; KEGG: mva:Mvan_0099
FT                   pirin domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77262"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D5USX5"
FT                   /inference="protein motif:PFAM:PF05726"
FT                   /protein_id="ADG77262.1"
FT                   /translation="MPAVTADTLTLPHIAAATAGETDRPVRKITTGPRGYEGEGFPVVR
FT                   AFAGVHPRDLDPFVHMDQMGEVEYEPGEPKGTSWHPHRGFETVTYMIDGLFQHQDSHGG
FT                   GGLISDGATQWMTAGSGILHIETPPAELVESGGTFHGIQLWVNLPASEKFSTPAYQNLE
FT                   GGQTKLVTTPDGGALIRIVAGEVDGHQGPGSTRTPINFVHATVAPGAEASLPWNRDFNA
FT                   LVYVLSGRGTVGPVGHPIHEGQLAQLGPGDRITVRADESQDANRPALEVLILGGQPIRE
FT                   PVVQYGPFVMNTKAELIQAMEDFNAGKFGHIPPDALMPHVVR"
     MPAVTADTLT LPHIAAATAG ETDRPVRKIT TGPRGYEGEG FPVVRAFAGV HPRDLDPFVH        60
     MDQMGEVEYE PGEPKGTSWH PHRGFETVTY MIDGLFQHQD SHGGGGLISD GATQWMTAGS       120
     GILHIETPPA ELVESGGTFH GIQLWVNLPA SEKFSTPAYQ NLEGGQTKLV TTPDGGALIR       180
     IVAGEVDGHQ GPGSTRTPIN FVHATVAPGA EASLPWNRDF NALVYVLSGR GTVGPVGHPI       240
     HEGQLAQLGP GDRITVRADE SQDANRPALE VLILGGQPIR EPVVQYGPFV MNTKAELIQA       300
     MEDFNAGKFG HIPPDALMPH VVR                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page