(data stored in ACNUC1104 zone)

EMBL: CP001966.PE609

CP001966.PE609       Location/Qualifiers
FT   CDS             645623..646222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0625"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77263"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="UniProtKB/TrEMBL:D5USX6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77263.1"
FT                   /translation="MDTETMVEELQELIADLARERVRAGEEDGDGLEIRLDLDPDGQVI
FT                   ATAAPAPPATEAEIAQAEAALGRPYPPELRALLGVANGFPGYFYGDTLLGTSGVGTAGV
FT                   AGYPAQFPASIWGIAREYIDEWYAAEVGRLEFSPEDPLDCIPLASDPDASGAAFVVAGS
FT                   GPGWDAGTVVELEGGVHRYENVREYLRARLALVREA"
     MDTETMVEEL QELIADLARE RVRAGEEDGD GLEIRLDLDP DGQVIATAAP APPATEAEIA        60
     QAEAALGRPY PPELRALLGV ANGFPGYFYG DTLLGTSGVG TAGVAGYPAQ FPASIWGIAR       120
     EYIDEWYAAE VGRLEFSPED PLDCIPLASD PDASGAAFVV AGSGPGWDAG TVVELEGGVH       180
     RYENVREYLR ARLALVREA                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page