(data stored in ACNUC1104 zone)

EMBL: CP001966.PE61

CP001966.PE61        Location/Qualifiers
FT   CDS             complement(62641..64212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0061"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; virulence
FT                   factor MVIN family protein; multi antimicrobial extrusion
FT                   protein MatE; KEGG: mpa:MAP0963c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76715"
FT                   /db_xref="GOA:D5UPU7"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPU7"
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /protein_id="ADG76715.1"
FT                   /translation="MPDYSIATEVSGSESGTAQGRASSGRIARAFGVQMVARVVGLMAS
FT                   IVTMALTSRHLGLTSYGHLQAAIAFVGLWTSFTELGIGAVIVRRVTSGLADLSQLVRVS
FT                   VGLSIAYCVPLGALTLFMGWGIYSSQGSEVVAMIAIVAVSLILTTLSSCFQPIFMTNVQ
FT                   FGAVAASDVVGRVLSLAGTVWLISIDAPLVWFAAVQIVPPLVALVIQAIAARRLVEISP
FT                   VFSVGESWHLIRESLPQTGVLIIAALYWRSDAFLLSILSTPQQLGAYSLAYGIAFNATV
FT                   ISATYLASALSTMTNLWATDRDEFARFTVRSMQAMLFLGTPMVAIGLTLAPGIIHLISD
FT                   SEFVEIGSVALGLLFIAVALRFVNAVLSQALFAAHDQVFLLRLNVVNLIGNIVLNVILI
FT                   PPFGAAGAGIALIASETVGLLVATWRLTRRSPYRTPWRFCLHLLVPLGATVGVCLALDD
FT                   VLPVLVTAMIAGVVFLAVNLALGPVHASAIRELLARGGEPDARDDESSKAPPTSSEPTS
FT                   SEGNTR"
     MPDYSIATEV SGSESGTAQG RASSGRIARA FGVQMVARVV GLMASIVTMA LTSRHLGLTS        60
     YGHLQAAIAF VGLWTSFTEL GIGAVIVRRV TSGLADLSQL VRVSVGLSIA YCVPLGALTL       120
     FMGWGIYSSQ GSEVVAMIAI VAVSLILTTL SSCFQPIFMT NVQFGAVAAS DVVGRVLSLA       180
     GTVWLISIDA PLVWFAAVQI VPPLVALVIQ AIAARRLVEI SPVFSVGESW HLIRESLPQT       240
     GVLIIAALYW RSDAFLLSIL STPQQLGAYS LAYGIAFNAT VISATYLASA LSTMTNLWAT       300
     DRDEFARFTV RSMQAMLFLG TPMVAIGLTL APGIIHLISD SEFVEIGSVA LGLLFIAVAL       360
     RFVNAVLSQA LFAAHDQVFL LRLNVVNLIG NIVLNVILIP PFGAAGAGIA LIASETVGLL       420
     VATWRLTRRS PYRTPWRFCL HLLVPLGATV GVCLALDDVL PVLVTAMIAG VVFLAVNLAL       480
     GPVHASAIRE LLARGGEPDA RDDESSKAPP TSSEPTSSEG NTR                         523
//

If you have problems or comments...

PBIL Back to PBIL home page