(data stored in ACNUC1104 zone)

EMBL: CP001966.PE613

CP001966.PE613       Location/Qualifiers
FT   CDS             complement(648883..650382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0629"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rha:RHA1_ro10372 major facilitator superfamily multidrug
FT                   resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77267"
FT                   /db_xref="GOA:D5USY0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5USY0"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG77267.1"
FT                   /translation="MQLPSNPMTDNLRRNRPADGVLIAVLCLGGLLASLMQSLVVPIVG
FT                   QLPHLLDTTTDNAAWVITATLLASSVAMPIAGRLGDMYGKRLVLLTSLLSLITGSLICA
FT                   LSHTLLLTVVGRSFQGFAMGLVPVGISLMRDELHARKIPGAVALMSAMLGVGGAIGIPF
FT                   GAYISEHFDYHTLFWFSLALGVVTLGLVFVVVPESPNRHPGTFDVVGTVGLTVGLVSVL
FT                   LSITKGQSWGWTSAATLGCAIGGALVLIAWGFWETRTRDSLVDLRISARRPILLTNLAS
FT                   IMVGFAMFSLMLTMPQLLQIPEATGYGLGQTMLNAGLWMVPGGLVMMALSPVSALLTKR
FT                   IGARLTLAIGATMSAIGYFALLGLTDATWKMSIGSMIVFGGVGVAYSAMPALIMANVPD
FT                   TESAAANGLNSLMRSVGTAISSAVMATILTRSTITLLAGTPREVTLPAEDAFTSGFVIA
FT                   GVVAAVAAVVALAIPRATKGGETTSAAPEDREIQEAGARTA"
     MQLPSNPMTD NLRRNRPADG VLIAVLCLGG LLASLMQSLV VPIVGQLPHL LDTTTDNAAW        60
     VITATLLASS VAMPIAGRLG DMYGKRLVLL TSLLSLITGS LICALSHTLL LTVVGRSFQG       120
     FAMGLVPVGI SLMRDELHAR KIPGAVALMS AMLGVGGAIG IPFGAYISEH FDYHTLFWFS       180
     LALGVVTLGL VFVVVPESPN RHPGTFDVVG TVGLTVGLVS VLLSITKGQS WGWTSAATLG       240
     CAIGGALVLI AWGFWETRTR DSLVDLRISA RRPILLTNLA SIMVGFAMFS LMLTMPQLLQ       300
     IPEATGYGLG QTMLNAGLWM VPGGLVMMAL SPVSALLTKR IGARLTLAIG ATMSAIGYFA       360
     LLGLTDATWK MSIGSMIVFG GVGVAYSAMP ALIMANVPDT ESAAANGLNS LMRSVGTAIS       420
     SAVMATILTR STITLLAGTP REVTLPAEDA FTSGFVIAGV VAAVAAVVAL AIPRATKGGE       480
     TTSAAPEDRE IQEAGARTA                                                    499
//

If you have problems or comments...

PBIL Back to PBIL home page