(data stored in ACNUC1104 zone)

EMBL: CP001966.PE62

CP001966.PE62        Location/Qualifiers
FT   CDS             64248..65309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0062"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   fre:Franean1_0751 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76716"
FT                   /db_xref="GOA:D5UPU8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPU8"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADG76716.1"
FT                   /translation="MRVTVPLAGGLSEQDWARRHAAGEVPDRSPYGLHRLDRHDMSVRF
FT                   ASADFGAGRVGRAAARVARSVRHRTGGYEFVEAFTSGGRIGEADAVLAYDERTAVPALL
FT                   TGRTPVAAGIGWLNRRAVAGGVHGALAARALPRAGAVWAQCSAVLPVIGAEWGVPASRL
FT                   QFVPLGIDTEFYGEQPLPETPGLVMSAGEDRFRDHATLIGAVAAVRRNRPETRLELASA
FT                   LPFDAPDGLVTVHTERLNGRIRELYRRASVVAVALHPTVTGSGLTVVLEAMASGRPIVV
FT                   TDNPGVDDYVEHGVTGLTVPAGDCAAMAGAIESLLSDDGMRIEMGRAAAKRAREQFTSA
FT                   IMVDHLARMLRRM"
     MRVTVPLAGG LSEQDWARRH AAGEVPDRSP YGLHRLDRHD MSVRFASADF GAGRVGRAAA        60
     RVARSVRHRT GGYEFVEAFT SGGRIGEADA VLAYDERTAV PALLTGRTPV AAGIGWLNRR       120
     AVAGGVHGAL AARALPRAGA VWAQCSAVLP VIGAEWGVPA SRLQFVPLGI DTEFYGEQPL       180
     PETPGLVMSA GEDRFRDHAT LIGAVAAVRR NRPETRLELA SALPFDAPDG LVTVHTERLN       240
     GRIRELYRRA SVVAVALHPT VTGSGLTVVL EAMASGRPIV VTDNPGVDDY VEHGVTGLTV       300
     PAGDCAAMAG AIESLLSDDG MRIEMGRAAA KRAREQFTSA IMVDHLARML RRM              353
//

If you have problems or comments...

PBIL Back to PBIL home page