(data stored in ACNUC1104 zone)

EMBL: CP001966.PE63

CP001966.PE63        Location/Qualifiers
FT   CDS             complement(65269..66063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0063"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family"
FT                   /note="KEGG: mmi:MMAR_4502 teichoic acid biosynthesis
FT                   protein; TIGRFAM: glycosyl transferase, WecB/TagA/CpsF
FT                   family; PFAM: glycosyl transferase WecB/TagA/CpsF"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76717"
FT                   /db_xref="GOA:D5UPU9"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPU9"
FT                   /inference="protein motif:TFAM:TIGR00696"
FT                   /protein_id="ADG76717.1"
FT                   /translation="MTALTQRMLVAGTVITRLSHAEALDLVERRAAAPGRRPLGLCSAN
FT                   LDHFHHFRPGRNHLGSAVDWVTLADGAPVVRRGERLTGERWPRVTGADLLPDVIAVCAE
FT                   HGFRIGFVGGTPEAHRALDATLRSTHPGLAIAGYWAPERDELEDPAANARLVAELRTAG
FT                   VTVLVVGLGKPRQEQWIDTWGAETGAGVLLPFGAAADFIAGTVDRAPEAWQRADLEWLY
FT                   RLKQEPRRLARRYLIQGPPALLRLRGARLVTSDATSARGDRP"
     MTALTQRMLV AGTVITRLSH AEALDLVERR AAAPGRRPLG LCSANLDHFH HFRPGRNHLG        60
     SAVDWVTLAD GAPVVRRGER LTGERWPRVT GADLLPDVIA VCAEHGFRIG FVGGTPEAHR       120
     ALDATLRSTH PGLAIAGYWA PERDELEDPA ANARLVAELR TAGVTVLVVG LGKPRQEQWI       180
     DTWGAETGAG VLLPFGAAAD FIAGTVDRAP EAWQRADLEW LYRLKQEPRR LARRYLIQGP       240
     PALLRLRGAR LVTSDATSAR GDRP                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page