(data stored in ACNUC1104 zone)

EMBL: CP001966.PE66

CP001966.PE66        Location/Qualifiers
FT   CDS             68178..69494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0066"
FT                   /product="O-antigen polymerase"
FT                   /note="KEGG: art:Arth_4126 O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76720"
FT                   /db_xref="GOA:D5UPV2"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPV2"
FT                   /inference="similar to AA sequence:KEGG:Arth_4126"
FT                   /protein_id="ADG76720.1"
FT                   /translation="MERLGLNRIAAPGALFLGVAGFFLLSMRQVLTVPGTFGYSLAQTL
FT                   FMGGALLWFATVLTGHTRLVRDWAVIAAVLGYVCASFISYAAAAARGILPISQSAVDRY
FT                   VLTDLMLAGTVLLTLTVLRTQHALRVMLGGLVLGGTVSALFALLDSSTGIDIAAQFRIP
FT                   GLTKGSDYVLIESLDRAGVTRPQGSAGHPLELGAVLTVLAPLALALYFNAKRRAADPRV
FT                   VRLWLACTVIILTADLATVSRSAVAGGLAAIAVMCWRWPVQRLAAILGTATAVVVVGVV
FT                   GQLTLVTALIETFAGSSKDPSLQSREVGRNFVAENLADNFWLGQGVGAYPTLKQPVLDN
FT                   QYLSRLMEAGIFGLLSLCMALVVTLYLAVRASQSKDDALAELAGGISGSAAALIVICLI
FT                   LDTSGFGQIWYLTWILLALAGVVYRLSRVREGELAAPPP"
     MERLGLNRIA APGALFLGVA GFFLLSMRQV LTVPGTFGYS LAQTLFMGGA LLWFATVLTG        60
     HTRLVRDWAV IAAVLGYVCA SFISYAAAAA RGILPISQSA VDRYVLTDLM LAGTVLLTLT       120
     VLRTQHALRV MLGGLVLGGT VSALFALLDS STGIDIAAQF RIPGLTKGSD YVLIESLDRA       180
     GVTRPQGSAG HPLELGAVLT VLAPLALALY FNAKRRAADP RVVRLWLACT VIILTADLAT       240
     VSRSAVAGGL AAIAVMCWRW PVQRLAAILG TATAVVVVGV VGQLTLVTAL IETFAGSSKD       300
     PSLQSREVGR NFVAENLADN FWLGQGVGAY PTLKQPVLDN QYLSRLMEAG IFGLLSLCMA       360
     LVVTLYLAVR ASQSKDDALA ELAGGISGSA AALIVICLIL DTSGFGQIWY LTWILLALAG       420
     VVYRLSRVRE GELAAPPP                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page