(data stored in ACNUC1104 zone)

EMBL: CP001966.PE68

CP001966.PE68        Location/Qualifiers
FT   CDS             70896..71678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0068"
FT                   /product="Glucose-1-phosphate cytidylyltransferase"
FT                   /EC_number="2.7.7.33"
FT                   /note="KEGG: sco:SCO0393 transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76722"
FT                   /db_xref="GOA:D5UPV4"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPV4"
FT                   /inference="protein motif:PRIAM:2.7.7.33"
FT                   /protein_id="ADG76722.1"
FT                   /translation="MKVVLFCGGYGMRMRGGADDTVPKPMQMVGPRPLIWHVMRYYAHF
FT                   GHTEFILCLGYGAGHIKDYFLNYRETASNDFVIRGGEVELLSTDLSDWTINFVDTGLES
FT                   AIGERLRRARPFLDGDEYFLANYADVLSDAPMNTIIDKVKAEGAAASMLLVPPQSSFHC
FT                   VDVDGDDKVTGITPVSEFPIWENGGYFVLTQEVFDHLPEGGDLVADACGALLKENRLIG
FT                   YRHRGFWKPADTFKERAELDAGYAQGHRPWMLWENGHS"
     MKVVLFCGGY GMRMRGGADD TVPKPMQMVG PRPLIWHVMR YYAHFGHTEF ILCLGYGAGH        60
     IKDYFLNYRE TASNDFVIRG GEVELLSTDL SDWTINFVDT GLESAIGERL RRARPFLDGD       120
     EYFLANYADV LSDAPMNTII DKVKAEGAAA SMLLVPPQSS FHCVDVDGDD KVTGITPVSE       180
     FPIWENGGYF VLTQEVFDHL PEGGDLVADA CGALLKENRL IGYRHRGFWK PADTFKERAE       240
     LDAGYAQGHR PWMLWENGHS                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page