(data stored in ACNUC1104 zone)

EMBL: CP001966.PE69

CP001966.PE69        Location/Qualifiers
FT   CDS             71675..72328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0069"
FT                   /product="LmbE family protein"
FT                   /note="PFAM: LmbE family protein; KEGG: msm:MSMEG_5978
FT                   GlcNAc-PI de-N-acetylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76723"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPV5"
FT                   /inference="protein motif:PFAM:PF02585"
FT                   /protein_id="ADG76723.1"
FT                   /translation="MIGLSPGAVREVAVLGAHCDDIAIGMGGTLLQIAEANPGVRVRAF
FT                   VGSGGGTPREAEERAALAAFAPGADLRITVLDLPDGRSPAYWEREKQALSEFRRSTDPD
FT                   VVFAPHRGDAHQDHRQLAEMVPTEFRDHLTLGYEILKWETDTPRPTVFNPLTVYAAMTK
FT                   ARLLTECYPSQTAHDWFDDESFLGLARLRGIQCRAPYAEGFMLEKAIVEFGGFR"
     MIGLSPGAVR EVAVLGAHCD DIAIGMGGTL LQIAEANPGV RVRAFVGSGG GTPREAEERA        60
     ALAAFAPGAD LRITVLDLPD GRSPAYWERE KQALSEFRRS TDPDVVFAPH RGDAHQDHRQ       120
     LAEMVPTEFR DHLTLGYEIL KWETDTPRPT VFNPLTVYAA MTKARLLTEC YPSQTAHDWF       180
     DDESFLGLAR LRGIQCRAPY AEGFMLEKAI VEFGGFR                                217
//

If you have problems or comments...

PBIL Back to PBIL home page