(data stored in ACNUC1104 zone)

EMBL: CP001966.PE7

CP001966.PE7         Location/Qualifiers
FT   CDS             7677..9272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0007"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="KEGG: nfa:nfa51130 putative transporter; TIGRFAM:
FT                   drug resistance transporter, EmrB/QacA subfamily; PFAM:
FT                   major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76661"
FT                   /db_xref="GOA:D5UPA9"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPA9"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ADG76661.1"
FT                   /translation="MSASSGALSAPKRWISLATVCIAVLMTGMDNSIVTIALPTLSNEF
FT                   GGGMSALQWIVDSYTLVFAGLLLATGYFGDRIGRRKVLVAGLVCFIVISVLATRSTSLA
FT                   QLITARAALGAAAALIFPATLAIISVLFPEKQERTKAIAVWSAAAGASIAIGPVVGGYL
FT                   VEHFAWSSVFWINVPISVIAIIGCLTLVPESFGSERPSFDLFGVLLSISGITLLVWALI
FT                   EAPNFGWGSAPVVGALVAAAVFLVTFVVYERRQANPVLDVTLFRSRGFAMGSFAICAGF
FT                   FCLLGFVFITIMYFQAVLGYGPLETAVRVIPFALVAVAVTPLAALANTERRMRFAISTG
FT                   LAIMAAGFVFTSRLTESADYLTQILPSMSVIAVGLGLLQGPATTSVMTSVPSGEAGAGS
FT                   AVNDTTREVGGALGVAILGSVVAHLYSARVAEDVARLPVAPGIRAEAESSVIGGVRAIG
FT                   AAPPELQAALGHTVQQAFVSAMQSANLVAAGVGAVACVVVAVFLRTRPEARHRRSTSQT
FT                   QVSVHDLVGRRAGE"
     MSASSGALSA PKRWISLATV CIAVLMTGMD NSIVTIALPT LSNEFGGGMS ALQWIVDSYT        60
     LVFAGLLLAT GYFGDRIGRR KVLVAGLVCF IVISVLATRS TSLAQLITAR AALGAAAALI       120
     FPATLAIISV LFPEKQERTK AIAVWSAAAG ASIAIGPVVG GYLVEHFAWS SVFWINVPIS       180
     VIAIIGCLTL VPESFGSERP SFDLFGVLLS ISGITLLVWA LIEAPNFGWG SAPVVGALVA       240
     AAVFLVTFVV YERRQANPVL DVTLFRSRGF AMGSFAICAG FFCLLGFVFI TIMYFQAVLG       300
     YGPLETAVRV IPFALVAVAV TPLAALANTE RRMRFAISTG LAIMAAGFVF TSRLTESADY       360
     LTQILPSMSV IAVGLGLLQG PATTSVMTSV PSGEAGAGSA VNDTTREVGG ALGVAILGSV       420
     VAHLYSARVA EDVARLPVAP GIRAEAESSV IGGVRAIGAA PPELQAALGH TVQQAFVSAM       480
     QSANLVAAGV GAVACVVVAV FLRTRPEARH RRSTSQTQVS VHDLVGRRAG E                531
//

If you have problems or comments...

PBIL Back to PBIL home page