(data stored in ACNUC1104 zone)

EMBL: CP001966.PE72

CP001966.PE72        Location/Qualifiers
FT   CDS             75862..76335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0072"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rop:ROP_23330 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76726"
FT                   /db_xref="GOA:D5UPV8"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPV8"
FT                   /inference="similar to AA sequence:KEGG:ROP_23330"
FT                   /protein_id="ADG76726.1"
FT                   /translation="MNHAPADATTSSRSLRIWGWVGAAVALATSLVHLPMLGDKSWVVS
FT                   IIVAAMLIGCAHCSVCLFRNPTVSAWVRTAAMGVIMIALHPVLMSAMGHGSGMSMDHAM
FT                   AGMDMGGMEMGGMASMEPWMTLMIVFAAAEIVVAVAALGVIALRNRGTSRAAG"
     MNHAPADATT SSRSLRIWGW VGAAVALATS LVHLPMLGDK SWVVSIIVAA MLIGCAHCSV        60
     CLFRNPTVSA WVRTAAMGVI MIALHPVLMS AMGHGSGMSM DHAMAGMDMG GMEMGGMASM       120
     EPWMTLMIVF AAAEIVVAVA ALGVIALRNR GTSRAAG                                157
//

If you have problems or comments...

PBIL Back to PBIL home page