(data stored in ACNUC1104 zone)

EMBL: CP001966.PE73

CP001966.PE73        Location/Qualifiers
FT   CDS             76388..77113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0073"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfa:nfa11270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76727"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPV9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76727.1"
FT                   /translation="MNATTDFHKPAVRRAAAVAATGALIVGLTGGIAAAEPDAQTTPTT
FT                   PASELLLEQKDFPGGYWVVPSPQQRLANELGADPLTLVASAKVNPPECKNVLTAAKNGG
FT                   GTDANTVAGVHDQDRKSLSESLVPKAADVDTLKVGLLKLCSDVTIEANDPKGGVVKVRA
FT                   KTKEVASDKQKATFEIVIDGTRTKGTDSFPVQQKVLFGVASLRGYTVAVQGTKLGGDPD
FT                   RGEFDSFFSKSVNKVKDAK"
     MNATTDFHKP AVRRAAAVAA TGALIVGLTG GIAAAEPDAQ TTPTTPASEL LLEQKDFPGG        60
     YWVVPSPQQR LANELGADPL TLVASAKVNP PECKNVLTAA KNGGGTDANT VAGVHDQDRK       120
     SLSESLVPKA ADVDTLKVGL LKLCSDVTIE ANDPKGGVVK VRAKTKEVAS DKQKATFEIV       180
     IDGTRTKGTD SFPVQQKVLF GVASLRGYTV AVQGTKLGGD PDRGEFDSFF SKSVNKVKDA       240
     K                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page