(data stored in ACNUC1104 zone)

EMBL: CP001966.PE74

CP001966.PE74        Location/Qualifiers
FT   CDS             77116..78957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0074"
FT                   /product="Cytochrome c oxidase caa3-type, assembly factor
FT                   CtaG-related protein"
FT                   /note="PFAM: Cytochrome c oxidase caa3-type, assembly
FT                   factor CtaG-related; KEGG: mbt:JTY_0106 putative integral
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76728"
FT                   /db_xref="GOA:D5UPW0"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPW0"
FT                   /inference="protein motif:PFAM:PF09678"
FT                   /protein_id="ADG76728.1"
FT                   /translation="MAEAVAPERPSPTPSDRPGHTPRTGAVALGVGAAVALAVVLWLVT
FT                   SEGEIRYDINGDSYPGALTAYGASIGRLAGTVAAALTFGALGYAVFRTKPQDGGELGLR
FT                   GYVTQLHARRYAAVWAVVSAPMILLAASDSAGQDLVATYRVGGLFALVSASEAAKGWIV
FT                   SLICAVIVIIAMRNCLTWVAHLWILLPAGIGLLATVVTANEAQGPKHDYSTAALITIAL
FT                   AGALWLGGLWSSVRLPERPEKRWTAPAFATLVLANGAVLAVVYAPGSDLWVTWYGWLYI
FT                   ATAVLIAAAALAQYLRARAPAAGLLTASIGTALAASLLTPPPFLRKRFTVGEVFMGYDL
FT                   PDPPNALRLATLWRFDLNFVLIVAAFAVGYLLLVRRTTSWPWYRTACFLFGCFALLVLT
FT                   SSGVSTYSKAMFSVHMVSHMLMTSLVPVFLLLGAPITLLRDTLTGAPKRWLELFLESKS
FT                   FVVLMRPAVQLLMFALMLYGLYFTPLFDRIGRYHWGHLGINLALLFTGFLFYWRVFQID
FT                   PVPKELPFIGRIGMLLAMMPISMVFALIVMTMDGLVGSRLYYYLDLSWMTDLQRDQFVG
FT                   GVAAWAVDEAAIALVTLGLVLHWAWQNRGEDSEPELL"
     MAEAVAPERP SPTPSDRPGH TPRTGAVALG VGAAVALAVV LWLVTSEGEI RYDINGDSYP        60
     GALTAYGASI GRLAGTVAAA LTFGALGYAV FRTKPQDGGE LGLRGYVTQL HARRYAAVWA       120
     VVSAPMILLA ASDSAGQDLV ATYRVGGLFA LVSASEAAKG WIVSLICAVI VIIAMRNCLT       180
     WVAHLWILLP AGIGLLATVV TANEAQGPKH DYSTAALITI ALAGALWLGG LWSSVRLPER       240
     PEKRWTAPAF ATLVLANGAV LAVVYAPGSD LWVTWYGWLY IATAVLIAAA ALAQYLRARA       300
     PAAGLLTASI GTALAASLLT PPPFLRKRFT VGEVFMGYDL PDPPNALRLA TLWRFDLNFV       360
     LIVAAFAVGY LLLVRRTTSW PWYRTACFLF GCFALLVLTS SGVSTYSKAM FSVHMVSHML       420
     MTSLVPVFLL LGAPITLLRD TLTGAPKRWL ELFLESKSFV VLMRPAVQLL MFALMLYGLY       480
     FTPLFDRIGR YHWGHLGINL ALLFTGFLFY WRVFQIDPVP KELPFIGRIG MLLAMMPISM       540
     VFALIVMTMD GLVGSRLYYY LDLSWMTDLQ RDQFVGGVAA WAVDEAAIAL VTLGLVLHWA       600
     WQNRGEDSEP ELL                                                          613
//

If you have problems or comments...

PBIL Back to PBIL home page